• Gene id: 83460

Gene Summary

• Gene Symbol: EMC6   Gene   UCSC   Ensembl
• Aliases: RAB5IFL, TMEM93
• Gene name: ER membrane protein complex subunit 6
• Alternate names: ER membrane protein complex subunit 6, transmembrane protein 93,
• Gene location: 17p13.2 (3668722: 3669668)     Exons: 2     NC_000017.11

Protein Summary

• Protein general information: Q9BV81  
  • Name: ER membrane protein complex subunit 6 (Transmembrane protein 93)
  • Length: 110  
  • Mass: 12017
• Sequence:

  MAAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYGFIFYLLASVLLSLLLILKAGRRWN
  KYFKSRRPLFTGGLIGGLFTYVLFWTFLYGMVHVY

• Structural information:
  • Interpro: IPR008504  IPR029008  
  • STRING: ENSP00000380322
• Other Databases: GeneCards:  EMC6  Malacards:  EMC6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000045	autophagosome assembly	IBA	biological process
GO:0072546	ER membrane protein complex	IBA	cellular component
GO:0097631	integral component of omegasome membrane	IDA	cellular component
GO:0030176	integral component of endoplasmic reticulum membrane	IDA	cellular component
GO:0072546	ER membrane protein complex	IDA	cellular component
GO:0016021	integral component of membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000045	autophagosome assembly	IMP	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0072546	ER membrane protein complex	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)