• Gene id: 83452

Gene Summary

• Gene Symbol: RAB33B   Gene   UCSC   Ensembl
• Aliases: SMC2
• Gene name: RAB33B, member RAS oncogene family
• Alternate names: ras-related protein Rab-33B,
• Gene location: 4q31.1 (139453231: 139476608)     Exons: 3     NC_000004.12
• Gene summary(Entrez): This gene encodes a small GTP-binding protein of the Rab GTPase family, whose members function in vesicle transport during protein secretion and endocytosis. Rab GTPases are active, membrane-associated proteins that recruit effector proteins in the GTP-bo
• OMIM: 603108

Protein Summary

• Protein general information: Q9H082  
  • Name: Ras related protein Rab 33B
  • Length: 229  
  • Mass: 25718
• Sequence:

  MAEEMESSLEASFSSSGAVSGASGFLPPARSRIFKIIVIGDSNVGKTCLTYRFCAGRFPDRTEATIGVDFRERAV
  EIDGERIKIQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDMTNMASFHSLPSWIEECKQHLLANDIPRILVGNKC
  DLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLKSHKPLMLSQPPDNGIILKPEPKPAM
  TCWC

• Structural information:
  • Interpro: IPR027417  IPR041822  IPR005225  IPR001806  
  • Prosite: PS51419
  • CDD: cd04115
  • DIP: 61978
  • STRING: ENSP00000306496
• Other Databases: GeneCards:  RAB33B  Malacards:  RAB33B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006886	intracellular protein transport	IBA	biological process
GO:0032482	Rab protein signal transduction	IBA	biological process
GO:0012505	endomembrane system	IBA	cellular component
GO:0003924	GTPase activity	IBA	molecular function
GO:0005796	Golgi lumen	IDA	cellular component
GO:2000156	regulation of retrograde vesicle-mediated transport, Golgi to ER	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0032482	Rab protein signal transduction	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0006914	autophagy	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000045	autophagosome assembly	IEA	biological process
GO:0098793	presynapse	IEA	cellular component
GO:0005796	Golgi lumen	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:1903434	negative regulation of constitutive secretory pathway	IMP	biological process
GO:0006891	intra-Golgi vesicle-mediated transport	IMP	biological process
GO:0034067	protein localization to Golgi apparatus	IMP	biological process
GO:0001558	regulation of cell growth	IMP	NOT|biological process
GO:0050678	regulation of epithelial cell proliferation	IMP	NOT|biological process
GO:1903358	regulation of Golgi organization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0034067	protein localization to Golgi apparatus	IGI	biological process
GO:0048705	skeletal system morphogenesis	IMP	biological process
GO:0003924	GTPase activity	IMP	molecular function
GO:0006886	intracellular protein transport	IBA	biological process
GO:0032482	Rab protein signal transduction	IBA	biological process
GO:0012505	endomembrane system	IBA	cellular component
GO:0003924	GTPase activity	IBA	molecular function
GO:0005796	Golgi lumen	IDA	cellular component
GO:2000156	regulation of retrograde vesicle-mediated transport, Golgi to ER	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0032482	Rab protein signal transduction	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0006914	autophagy	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000045	autophagosome assembly	IEA	biological process
GO:0098793	presynapse	IEA	cellular component
GO:0005796	Golgi lumen	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:1903434	negative regulation of constitutive secretory pathway	IMP	biological process
GO:0006891	intra-Golgi vesicle-mediated transport	IMP	biological process
GO:0034067	protein localization to Golgi apparatus	IMP	biological process
GO:0001558	regulation of cell growth	IMP	NOT|biological process
GO:0050678	regulation of epithelial cell proliferation	IMP	NOT|biological process
GO:1903358	regulation of Golgi organization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0034067	protein localization to Golgi apparatus	IGI	biological process
GO:0048705	skeletal system morphogenesis	IMP	biological process
GO:0003924	GTPase activity	IMP	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04140	Autophagy - animal

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881