About Us

Search Result


Gene id 8345
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol H2BC9   Gene   UCSC   Ensembl
Aliases H2B/j, H2BFJ, HIST1H2BH
Gene name H2B clustered histone 9
Alternate names histone H2B type 1-H, H2B histone family, member J, histone 1, H2bh, histone H2B.j, histone cluster 1 H2B family member h, histone cluster 1, H2bh,
Gene location 6p22.2 (26251613: 26252074)     Exons: 1     NC_000006.12
Gene summary(Entrez) Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA
OMIM 609677

Protein Summary

Protein general information Q93079  

Name: Histone H2B type 1 H (H2B clustered histone 9) (Histone H2B.j) (H2B/j)

Length: 126  Mass: 13892

Sequence MPDPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIA
GEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Structural information
Interpro:  IPR009072  IPR007125  IPR000558  
Prosite:   PS00357
STRING:   ENSP00000479169
Other Databases GeneCards:  H2BC9  Malacards:  H2BC9

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0003677 DNA binding
IBA molecular function
GO:0006334 nucleosome assembly
IBA biological process
GO:0000786 nucleosome
IEA cellular component
GO:0003677 DNA binding
IEA molecular function
GO:0046982 protein heterodimerizatio
n activity
IEA molecular function
GO:0000786 nucleosome
IEA cellular component
GO:0005634 nucleus
IEA cellular component
GO:0003677 DNA binding
IEA molecular function
GO:0005694 chromosome
IEA cellular component
GO:0016567 protein ubiquitination
TAS biological process
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005634 nucleus
IEA cellular component
GO:0005694 chromosome
IEA cellular component
GO:0005654 nucleoplasm
IDA cellular component
GO:0005829 cytosol
IDA cellular component
GO:0005634 nucleus
IDA cellular component
GO:0032991 protein-containing comple
x
IDA cellular component
GO:0005634 nucleus
HDA cellular component
GO:0003677 DNA binding
NAS molecular function
GO:0070062 extracellular exosome
HDA cellular component
GO:0000786 nucleosome
NAS cellular component
GO:0070062 extracellular exosome
HDA cellular component
GO:0006334 nucleosome assembly
NAS biological process
GO:0005515 protein binding
IPI molecular function
GO:0019899 enzyme binding
IPI molecular function
GO:0044389 ubiquitin-like protein li
gase binding
IPI molecular function
GO:0097677 STAT family protein bindi
ng
IPI molecular function
GO:0003677 DNA binding
IBA molecular function
GO:0006334 nucleosome assembly
IBA biological process
GO:0000786 nucleosome
IEA cellular component
GO:0003677 DNA binding
IEA molecular function
GO:0046982 protein heterodimerizatio
n activity
IEA molecular function
GO:0000786 nucleosome
IEA cellular component
GO:0005634 nucleus
IEA cellular component
GO:0003677 DNA binding
IEA molecular function
GO:0005694 chromosome
IEA cellular component
GO:0016567 protein ubiquitination
TAS biological process
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005634 nucleus
IEA cellular component
GO:0005694 chromosome
IEA cellular component
GO:0005654 nucleoplasm
IDA cellular component
GO:0005829 cytosol
IDA cellular component
GO:0005634 nucleus
IDA cellular component
GO:0032991 protein-containing comple
x
IDA cellular component
GO:0005634 nucleus
HDA cellular component
GO:0003677 DNA binding
NAS molecular function
GO:0070062 extracellular exosome
HDA cellular component
GO:0000786 nucleosome
NAS cellular component
GO:0070062 extracellular exosome
HDA cellular component
GO:0006334 nucleosome assembly
NAS biological process
GO:0005515 protein binding
IPI molecular function
GO:0019899 enzyme binding
IPI molecular function
GO:0044389 ubiquitin-like protein li
gase binding
IPI molecular function
GO:0097677 STAT family protein bindi
ng
IPI molecular function

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa05034Alcoholism
hsa05203Viral carcinogenesis
hsa05322Systemic lupus erythematosus
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract