• Gene id: 8338

Gene Summary

• Gene Symbol: H2AC20   Gene   UCSC   Ensembl
• Aliases: H2A, H2A-GL101, H2A/q, H2AFQ, HIST2H2AC
• Gene name: H2A clustered histone 20
• Alternate names: histone H2A type 2-C, H2A histone family, member Q, histone 2, H2ac, histone H2A-GL101, histone H2A/q, histone IIa, histone cluster 2 H2A family member c, histone cluster 2, H2ac,
• Gene location: 1q21.2 (149886917: 149887410)     Exons: 2     NC_000001.11
• Gene summary(Entrez): Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA
• OMIM: 602797

Protein Summary

• Protein general information: Q16777  
  • Name: Histone H2A type 2 C (H2A clustered histone 20) (Histone H2A GL101) (Histone H2A/q)
  • Length: 129  
  • Mass: 13988
• Sequence:

  MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNK
  KTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHKAKSK

• Structural information:
  • Interpro: IPR009072  IPR002119  IPR007125  IPR032454  IPR032458  
  • Prosite: PS00046
  • CDD: cd00074
  • STRING: ENSP00000332194
• Other Databases: GeneCards:  H2AC20  Malacards:  H2AC20

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006325	chromatin organization	IBA	biological process
GO:0006342	chromatin silencing	IBA	biological process
GO:0003677	DNA binding	IBA	molecular function
GO:0000790	nuclear chromatin	IBA	cellular component
GO:0000786	nucleosome	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0000786	nucleosome	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0005634	nucleus	HDA	cellular component
GO:0003674	molecular_function	ND	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05034	Alcoholism
hsa04217	Necroptosis
hsa05322	Systemic lupus erythematosus

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray