• Gene id: 8324

Gene Summary

• Gene Symbol: FZD7   Gene   UCSC   Ensembl
• Aliases: FzE3
• Gene name: frizzled class receptor 7
• Alternate names: frizzled-7, Frizzled, drosophila, homolog of, 7, frizzled 7, seven transmembrane spanning receptor, frizzled family receptor 7, frizzled homolog 7, fz-7, hFz7,
• Gene location: 2q33.1 (202034586: 202038436)     Exons: 4     NC_000002.12
• Gene summary(Entrez): Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD7 protein contains an N-terminal signal sequence, 10 cysteine residues typical of the cysteine-rich extracellular domain o
• OMIM: 603410

Protein Summary

• Protein general information: O75084  
  • Name: Frizzled 7 (Fz 7) (hFz7) (FzE3)
  • Length: 574  
  • Mass: 63620
  • Tissue specificity: High expression in adult skeletal muscle and fetal kidney, followed by fetal lung, adult heart, brain, and placenta. Specifically expressed in squamous cell esophageal carcinomas.
• Sequence:

  MRDPGAAAPLSSLGLCALVLALLGALSAGAGAQPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTN
  QEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCEN
  FPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTALPPGASDGRGRPAFPFSCPRQLKVPPYLGYRFL
  GERDCGAPCEPGRANGLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVA
  VAHVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLTWFLAAGMKWGHEAIE
  ANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRI
  RTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSP
  DFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV

• Structural information:
  • Protein Domains: (44..16-)
    (/note="FZ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00090"-)
  • Interpro: IPR042742  IPR015526  IPR000539  IPR020067  IPR036790   IPR026552  IPR017981  
  • Prosite: PS50038 PS50261
  • CDD: cd07466
  • PDB: 4Z33 5T44 5URV 5WBS 6NE2 6NE4 6O3A 6O3B
  • PDBsum: 4Z33 5T44 5URV 5WBS 6NE2 6NE4 6O3A 6O3B
  • STRING: ENSP00000286201
• Other Databases: GeneCards:  FZD7  Malacards:  FZD7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042813	Wnt-activated receptor activity	NAS	molecular function
GO:0017147	Wnt-protein binding	NAS	molecular function
GO:0060071	Wnt signaling pathway, planar cell polarity pathway	NAS	biological process
GO:0042813	Wnt-activated receptor activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0016021	integral component of membrane	IBA	cellular component
GO:0017147	Wnt-protein binding	IBA	molecular function
GO:0060070	canonical Wnt signaling pathway	IBA	biological process
GO:0055038	recycling endosome membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005109	frizzled binding	IPI	molecular function
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0042813	Wnt-activated receptor activity	IEA	molecular function
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0060071	Wnt signaling pathway, planar cell polarity pathway	TAS	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042813	Wnt-activated receptor activity	IDA	molecular function
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0042813	Wnt-activated receptor activity	IEA	molecular function
GO:0035567	non-canonical Wnt signaling pathway	IEA	biological process
GO:0060070	canonical Wnt signaling pathway	IEA	biological process
GO:0048103	somatic stem cell division	IEA	biological process
GO:0034446	substrate adhesion-dependent cell spreading	IEA	biological process
GO:0033077	T cell differentiation in thymus	IEA	biological process
GO:0017147	Wnt-protein binding	IEA	molecular function
GO:0014834	skeletal muscle satellite cell maintenance involved in skeletal muscle regeneration	IEA	biological process
GO:0010812	negative regulation of cell-substrate adhesion	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:2000726	negative regulation of cardiac muscle cell differentiation	IGI	biological process
GO:0017147	Wnt-protein binding	IPI	molecular function
GO:0030165	PDZ domain binding	IPI	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0038031	non-canonical Wnt signaling pathway via JNK cascade	IMP	biological process
GO:0042666	negative regulation of ectodermal cell fate specification	IMP	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0060054	positive regulation of epithelial cell proliferation involved in wound healing	IMP	biological process
GO:0060231	mesenchymal to epithelial transition	IMP	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0042327	positive regulation of phosphorylation	IDA	biological process
GO:0046330	positive regulation of JNK cascade	IC	biological process
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0006355	regulation of transcription, DNA-templated	IMP	biological process
GO:0010812	negative regulation of cell-substrate adhesion	IMP	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0019827	stem cell population maintenance	IMP	biological process
GO:0060828	regulation of canonical Wnt signaling pathway	IMP	biological process
GO:0060070	canonical Wnt signaling pathway	IMP	biological process
GO:0060070	canonical Wnt signaling pathway	IMP	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0030165	PDZ domain binding	IPI	molecular function
GO:0030165	PDZ domain binding	IPI	molecular function
GO:0071300	cellular response to retinoic acid	ISS	biological process
GO:0030182	neuron differentiation	ISS	biological process
GO:0030165	PDZ domain binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05010	Alzheimer disease
hsa05165	Human papillomavirus infection
hsa05205	Proteoglycans in cancer
hsa04310	Wnt signaling pathway
hsa04150	mTOR signaling pathway
hsa04390	Hippo signaling pathway
hsa05225	Hepatocellular carcinoma
hsa04934	Cushing syndrome
hsa05226	Gastric cancer
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa05224	Breast cancer
hsa04916	Melanogenesis
hsa05217	Basal cell carcinoma

Diseases

Associated diseases	References
Hepatocellular carcinoma	KEGG:H00048
Breast cancer	KEGG:H00031
Hepatocellular carcinoma	KEGG:H00048
Breast cancer	KEGG:H00031
nephroblastoma	PMID:12057921
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)