• Gene id: 8323

Gene Summary

• Gene Symbol: FZD6   Gene   UCSC   Ensembl
• Aliases: FZ-6, FZ6, HFZ6, NDNC1, NDNC10
• Gene name: frizzled class receptor 6
• Alternate names: frizzled-6, frizzled 6, seven transmembrane spanning receptor, frizzled family receptor 6, frizzled homolog 6, seven transmembrane helix receptor,
• Gene location: 8q22.3 (103298493: 103332865)     Exons: 8     NC_000008.11
• Gene summary(Entrez): This gene represents a member of the 'frizzled' gene family, which encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The protein encoded by this family member contains a signal peptide, a cysteine-rich domain in the N-t
• OMIM: 601150

Protein Summary

• Protein general information: O60353  
  • Name: Frizzled 6 (Fz 6) (hFz6)
  • Length: 706  
  • Mass: 79292
  • Tissue specificity: Detected in adult heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, thymus, prostate, testis, ovary, small intestine and colon. In the fetus, expressed in brain, lung, liver and kidney.
• Sequence:

  MEMFTFLLTCIFLPLLRGHSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEHFLPLANLECSPNIET
  FLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPHTEFLGPQKKT
  EQVQRDIGFWCPRHLKTSGGQGYKFLGIDQCAPPCPNMYFKSDELEFAKSFIGTVSIFCLCATLFTFLTFLIDVR
  RFRYPERPIIYYSVCYSIVSLMYFIGFLLGDSTACNKADEKLELGDTVVLGSQNKACTVLFMLLYFFTMAGTVWW
  VILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGTPGFLTVMLLAMNKVEGDNISGVCFVGLYDLDASRYFVLLPL
  CLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVFSGLYLVPLVTLLGCYVYEQVNRITWEITWV
  SDHCRQYHIPCPYQAKAKARPELALFMIKYLMTLIVGISAVFWVGSKKTCTEWAGFFKRNRKRDPISESRRVLQE
  SCEFFLKHNSKVKHKKKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTEIQTSPETSMREV
  KADGASTPRLREQDCGEPASPAASISRLSGEQVDGKGQAGSVSESARSEGRISPKSDITDTGLAQSNNLQVPSSS
  EPSSLKGSTSLLVHPVSGVRKEQGGGCHSDT

• Structural information:
  • Protein Domains: (19..13-)
    (/note="FZ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00090"-)
  • Interpro: IPR015526  IPR000539  IPR020067  IPR036790  IPR041770   IPR026543  IPR017981  
  • Prosite: PS50038 PS50261
  • CDD: cd07450
  • DIP: 59893
  • STRING: ENSP00000351605
• Other Databases: GeneCards:  FZD6  Malacards:  FZD6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007223	Wnt signaling pathway, calcium modulating pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001942	hair follicle development	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0030168	platelet activation	IEA	biological process
GO:0035880	embryonic nail plate morphogenesis	IEA	biological process
GO:0042472	inner ear morphogenesis	IEA	biological process
GO:0045177	apical part of cell	IEA	cellular component
GO:0048105	establishment of body hair planar orientation	IEA	biological process
GO:0001736	establishment of planar polarity	IEA	biological process
GO:0001843	neural tube closure	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016327	apicolateral plasma membrane	IEA	cellular component
GO:0017147	Wnt-protein binding	IEA	molecular function
GO:0030901	midbrain development	IEA	biological process
GO:0033278	cell proliferation in midbrain	IEA	biological process
GO:0060071	Wnt signaling pathway, planar cell polarity pathway	IEA	biological process
GO:0042813	Wnt-activated receptor activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0017147	Wnt-protein binding	ISS	molecular function
GO:0035567	non-canonical Wnt signaling pathway	IDA	biological process
GO:0043433	negative regulation of DNA-binding transcription factor activity	IDA	biological process
GO:0005887	integral component of plasma membrane	ISS	cellular component
GO:0090090	negative regulation of canonical Wnt signaling pathway	IMP	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0001540	amyloid-beta binding	NAS	NOT|molecular function
GO:0042813	Wnt-activated receptor activity	NAS	molecular function
GO:1904693	midbrain morphogenesis	TAS	biological process
GO:0017147	Wnt-protein binding	NAS	molecular function
GO:0060071	Wnt signaling pathway, planar cell polarity pathway	NAS	biological process
GO:0042813	Wnt-activated receptor activity	IBA	molecular function
GO:0060070	canonical Wnt signaling pathway	IBA	biological process
GO:0017147	Wnt-protein binding	IBA	molecular function
GO:0016021	integral component of membrane	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0005789	endoplasmic reticulum membrane	ISS	cellular component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0042813	Wnt-activated receptor activity	IEA	molecular function
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0016020	membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05010	Alzheimer disease
hsa05165	Human papillomavirus infection
hsa05205	Proteoglycans in cancer
hsa04310	Wnt signaling pathway
hsa04150	mTOR signaling pathway
hsa04390	Hippo signaling pathway
hsa05225	Hepatocellular carcinoma
hsa04934	Cushing syndrome
hsa05226	Gastric cancer
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa05224	Breast cancer
hsa04916	Melanogenesis
hsa05217	Basal cell carcinoma

Diseases

Associated diseases	References
Nonsyndromic congenital nail disorder	KEGG:H01307
Nonsyndromic congenital nail disorder	KEGG:H01307
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881