• Gene id: 8322

Gene Summary

• Gene Symbol: FZD4   Gene   UCSC   Ensembl
• Aliases: CD344, EVR1, FEVR, FZD4S, Fz-4, Fz4, FzE4, GPCR, hFz4
• Gene name: frizzled class receptor 4
• Alternate names: frizzled-4, WNT receptor frizzled-4, frizzled 4, seven transmembrane spanning receptor, frizzled family receptor 4, frizzled homolog 4,
• Gene location: 11q14.2 (86955394: 86945678)     Exons: 2     NC_000011.10
• Gene summary(Entrez): This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the be
• OMIM: 604579

Protein Summary

• Protein general information: Q9ULV1  
  • Name: Frizzled 4 (Fz 4) (hFz4) (FzE4) (CD antigen CD344)
  • Length: 537  
  • Mass: 59881
  • Tissue specificity: Almost ubiquitous (PubMed
• Sequence:

  MAWRGAGPSVPGAPGGVGLSLGLLLQLLLLLGPARGFGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDA
  ELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPP
  QNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAV
  WASLCFISTAFTVLTFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAAEPVLIQEGLKNT
  GCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADELTG
  LCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNLQKDGTKTDKLERLMVKIGVFSVLYTVPATC
  VIACYFYEISNWALFRYSADDSNMAVEMLKIFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNG
  WVKPGKGSETVV

• Structural information:
  • Protein Domains: (40..16-)
    (/note="FZ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00090"-)
  • Interpro: IPR015526  IPR000539  IPR020067  IPR036790  IPR041765   IPR026551  IPR017981  
  • Prosite: PS50038 PS50261
  • CDD: cd07448
  • PDB: 5BPB 5BPQ 5BQC 5BQE 5CL1 5CM4 5UWG 6BD4 6NE1
  • PDBsum: 5BPB 5BPQ 5BQC 5BQE 5CL1 5CM4 5UWG 6BD4 6NE1
  • STRING: ENSP00000434034
• Other Databases: GeneCards:  FZD4  Malacards:  FZD4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001540	amyloid-beta binding	IPI	molecular function
GO:0001540	amyloid-beta binding	IPI	molecular function
GO:0001540	amyloid-beta binding	IPI	molecular function
GO:0038023	signaling receptor activity	ISS	molecular function
GO:0017147	Wnt-protein binding	TAS	molecular function
GO:0017147	Wnt-protein binding	TAS	molecular function
GO:0044877	protein-containing complex binding	IPI	molecular function
GO:0150012	positive regulation of neuron projection arborization	ISS	biological process
GO:0035567	non-canonical Wnt signaling pathway	TAS	biological process
GO:0030425	dendrite	ISS	cellular component
GO:0016055	Wnt signaling pathway	ISS	biological process
GO:0060070	canonical Wnt signaling pathway	TAS	biological process
GO:0042813	Wnt-activated receptor activity	IBA	molecular function
GO:0061299	retina vasculature morphogenesis in camera-type eye	IBA	biological process
GO:0060070	canonical Wnt signaling pathway	IBA	biological process
GO:0017147	Wnt-protein binding	IBA	molecular function
GO:0016021	integral component of membrane	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0042813	Wnt-activated receptor activity	IEA	molecular function
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007223	Wnt signaling pathway, calcium modulating pathway	TAS	biological process
GO:0030669	clathrin-coated endocytic vesicle membrane	TAS	cellular component
GO:0060071	Wnt signaling pathway, planar cell polarity pathway	TAS	biological process
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0061024	membrane organization	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042813	Wnt-activated receptor activity	IDA	molecular function
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0001553	luteinization	IEA	biological process
GO:0001570	vasculogenesis	IEA	biological process
GO:0005911	cell-cell junction	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0019955	cytokine binding	IEA	molecular function
GO:0030425	dendrite	IEA	cellular component
GO:0031987	locomotion involved in locomotory behavior	IEA	biological process
GO:0038023	signaling receptor activity	IEA	molecular function
GO:0042701	progesterone secretion	IEA	biological process
GO:0042813	Wnt-activated receptor activity	IEA	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0110135	Norrin signaling pathway	IEA	biological process
GO:0150012	positive regulation of neuron projection arborization	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0038023	signaling receptor activity	IEA	molecular function
GO:0150012	positive regulation of neuron projection arborization	IEA	biological process
GO:0001568	blood vessel development	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0007605	sensory perception of sound	IEA	biological process
GO:0010812	negative regulation of cell-substrate adhesion	IEA	biological process
GO:0017147	Wnt-protein binding	IEA	molecular function
GO:0030947	regulation of vascular endothelial growth factor receptor signaling pathway	IEA	biological process
GO:0034446	substrate adhesion-dependent cell spreading	IEA	biological process
GO:0035426	extracellular matrix-cell signaling	IEA	biological process
GO:0043507	positive regulation of JUN kinase activity	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0051091	positive regulation of DNA-binding transcription factor activity	IEA	biological process
GO:0060070	canonical Wnt signaling pathway	IEA	biological process
GO:0061299	retina vasculature morphogenesis in camera-type eye	IEA	biological process
GO:0061301	cerebellum vasculature morphogenesis	IEA	biological process
GO:0061304	retinal blood vessel morphogenesis	IEA	biological process
GO:1990830	cellular response to leukemia inhibitory factor	IEA	biological process
GO:0017147	Wnt-protein binding	IEA	molecular function
GO:0019955	cytokine binding	IPI	molecular function
GO:0004896	cytokine receptor activity	IDA	molecular function
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0110135	Norrin signaling pathway	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0110135	Norrin signaling pathway	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005887	integral component of plasma membrane	IC	cellular component
GO:0007223	Wnt signaling pathway, calcium modulating pathway	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IDA	biological process
GO:0010812	negative regulation of cell-substrate adhesion	IMP	biological process
GO:0061299	retina vasculature morphogenesis in camera-type eye	IMP	biological process
GO:0061299	retina vasculature morphogenesis in camera-type eye	IMP	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0019221	cytokine-mediated signaling pathway	IEA	biological process
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0030165	PDZ domain binding	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0071300	cellular response to retinoic acid	ISS	biological process
GO:0030165	PDZ domain binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030182	neuron differentiation	ISS	biological process
GO:0030165	PDZ domain binding	IPI	molecular function
GO:0030165	PDZ domain binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05010	Alzheimer disease
hsa05165	Human papillomavirus infection
hsa05205	Proteoglycans in cancer
hsa04310	Wnt signaling pathway
hsa04150	mTOR signaling pathway
hsa04390	Hippo signaling pathway
hsa05225	Hepatocellular carcinoma
hsa04934	Cushing syndrome
hsa05226	Gastric cancer
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa05224	Breast cancer
hsa04916	Melanogenesis
hsa05217	Basal cell carcinoma

Diseases

Associated diseases	References
Familial exudative vitreoretinopathy	KEGG:H00589
Familial exudative vitreoretinopathy	KEGG:H00589
Exudative vitreoretinopathy	PMID:12172548
prostate carcinoma in situ	PMID:18068632
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R