• Gene id: 8321

Gene Summary

• Gene Symbol: FZD1   Gene   UCSC   Ensembl
• Gene name: frizzled class receptor 1
• Alternate names: frizzled-1, Wnt receptor, frizzled 1, seven transmembrane spanning receptor, frizzled family receptor 1, frizzled homolog 1, frizzled, Drosophila, homolog of, 1, fz-1, fzE1, hFz1,
• Gene location: 7q21.13 (91264432: 91271325)     Exons: 1     NC_000007.14
• Gene summary(Entrez): Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD1 protein contains a signal peptide, a cysteine-rich domain in the N-terminal extracellular region, 7 transmembrane domain
• OMIM: 607647

Protein Summary

• Protein general information: Q9UP38  
  • Name: Frizzled 1 (Fz 1) (hFz1) (FzE1)
  • Length: 647  
  • Mass: 71158
  • Tissue specificity: Expressed in adult heart, placenta, lung, kidney, pancreas, prostate, and ovary and in fetal lung and kidney. {ECO
• Sequence:

  MAEEEAPKKSRAAGGGASWELCAGALSARLAEEGSGDAGGRRRPPVDPRRLARQLLLLLWLLEAPLLLGVRAQAA
  GQGPGQGPGPGQQPPPPPQQQQSGQQYNGERGISVPDHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEV
  HQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGE
  LCVGQNTSDKGTPTPSLLPEFWTSNPQHGGGGHRGGFPGGAGASERGKFSCPRALKVPSYLNYHFLGEKDCGAPC
  EPTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYTAVAVAYIAGFLL
  EDRVVCNDKFAEDGARTVAQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLA
  AWAVPAIKTITILALGQVDGDVLSGVCFVGLNNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGT
  KTEKLEKLMVRIGVFSVLYTVPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQAGGGAPPHPPMSPDF
  TVFMIKYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNSKQGETTV

• Structural information:
  • Protein Domains: (111..23-)
    (/note="FZ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00090"-)
  • Interpro: IPR015526  IPR000539  IPR020067  IPR036790  IPR026548   IPR017981  
  • Prosite: PS50038 PS50261
  • STRING: ENSP00000287934
• Other Databases: GeneCards:  FZD1  Malacards:  FZD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010976	positive regulation of neuron projection development	ISS	biological process
GO:1990909	Wnt signalosome	IC	cellular component
GO:0042813	Wnt-activated receptor activity	IDA	molecular function
GO:0042813	Wnt-activated receptor activity	TAS	molecular function
GO:0042813	Wnt-activated receptor activity	NAS	molecular function
GO:0099054	presynapse assembly	TAS	biological process
GO:0017147	Wnt-protein binding	NAS	molecular function
GO:1904953	Wnt signaling pathway involved in midbrain dopaminergic neuron differentiation	NAS	biological process
GO:0060070	canonical Wnt signaling pathway	IGI	biological process
GO:0060070	canonical Wnt signaling pathway	NAS	biological process
GO:0042813	Wnt-activated receptor activity	IBA	molecular function
GO:0060070	canonical Wnt signaling pathway	IBA	biological process
GO:0017147	Wnt-protein binding	IBA	molecular function
GO:0016021	integral component of membrane	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0005109	frizzled binding	IPI	molecular function
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0042813	Wnt-activated receptor activity	IEA	molecular function
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0060071	Wnt signaling pathway, planar cell polarity pathway	TAS	biological process
GO:1904886	beta-catenin destruction complex disassembly	TAS	biological process
GO:0042813	Wnt-activated receptor activity	IDA	molecular function
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0007267	cell-cell signaling	IEA	biological process
GO:0036520	astrocyte-dopaminergic neuron signaling	IEA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:1903204	negative regulation of oxidative stress-induced neuron death	IEA	biological process
GO:1905606	regulation of presynapse assembly	IEA	biological process
GO:0001934	positive regulation of protein phosphorylation	IEA	biological process
GO:0003149	membranous septum morphogenesis	IEA	biological process
GO:0003150	muscular septum morphogenesis	IEA	biological process
GO:0003151	outflow tract morphogenesis	IEA	biological process
GO:0017147	Wnt-protein binding	IEA	molecular function
GO:0030514	negative regulation of BMP signaling pathway	IEA	biological process
GO:0030855	epithelial cell differentiation	IEA	biological process
GO:0060022	hard palate development	IEA	biological process
GO:0060070	canonical Wnt signaling pathway	IEA	biological process
GO:0060412	ventricular septum morphogenesis	IEA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0090179	planar cell polarity pathway involved in neural tube closure	IEA	biological process
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0017147	Wnt-protein binding	IPI	molecular function
GO:0007267	cell-cell signaling	IDA	biological process
GO:0035425	autocrine signaling	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0051091	positive regulation of DNA-binding transcription factor activity	IDA	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IDA	biological process
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0042493	response to drug	IMP	biological process
GO:0044338	canonical Wnt signaling pathway involved in mesenchymal stem cell differentiation	IMP	biological process
GO:0044339	canonical Wnt signaling pathway involved in osteoblast differentiation	IMP	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0030165	PDZ domain binding	IPI	molecular function
GO:0030165	PDZ domain binding	IPI	molecular function
GO:0017147	Wnt-protein binding	IPI	molecular function
GO:0030182	neuron differentiation	ISS	biological process
GO:0030165	PDZ domain binding	IPI	molecular function
GO:0017147	Wnt-protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005925	focal adhesion	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05010	Alzheimer disease
hsa05165	Human papillomavirus infection
hsa05205	Proteoglycans in cancer
hsa04310	Wnt signaling pathway
hsa04150	mTOR signaling pathway
hsa04390	Hippo signaling pathway
hsa05225	Hepatocellular carcinoma
hsa04934	Cushing syndrome
hsa05226	Gastric cancer
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa05224	Breast cancer
hsa04916	Melanogenesis
hsa05217	Basal cell carcinoma

Diseases

Associated diseases	References
Breast carcinoma	PMID:15492823
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq