• Gene id: 8320

Gene Summary

• Gene Symbol: EOMES   Gene   UCSC   Ensembl
• Aliases: TBR2
• Gene name: eomesodermin
• Alternate names: eomesodermin homolog, T-box brain protein 2,
• Gene location: 3p24.1 (27722714: 27715948)     Exons: 7     NC_000003.12
• Gene summary(Entrez): This gene belongs to the TBR1 (T-box brain protein 1) sub-family of T-box genes that share the common DNA-binding T-box domain. The encoded protein is a transcription factor which is crucial for embryonic development of mesoderm and the central nervous sy
• OMIM: 604615

Protein Summary

• Protein general information: O95936  
  • Name: Eomesodermin homolog (T box brain protein 2) (T brain 2) (TBR 2)
  • Length: 686  
  • Mass: 72732
  • Tissue specificity: Expressed in CD8+ T-cells. {ECO
• Sequence:

  MQLGEQLLVSSVNLPGAHFYPLESARGGSGGSAGHLPSAAPSPQKLDLDKASKKFSGSLSCEAVSGEPAAASAGA
  PAAMLSDTDAGDAFASAAAVAKPGPPDGRKGSPCGEEELPSAAAAAAAAAAAAAATARYSMDSLSSERYYLQSPG
  PQGSELAAPCSLFPYQAAAGAPHGPVYPAPNGARYPYGSMLPPGGFPAAVCPPGRAQFGPGAGAGSGAGGSSGGG
  GGPGTYQYSQGAPLYGPYPGAAAAGSCGGLGGLGVPGSGFRAHVYLCNRPLWLKFHRHQTEMIITKQGRRMFPFL
  SFNINGLNPTAHYNVFVEVVLADPNHWRFQGGKWVTCGKADNNMQGNKMYVHPESPNTGSHWMRQEISFGKLKLT
  NNKGANNNNTQMIVLQSLHKYQPRLHIVEVTEDGVEDLNEPSKTQTFTFSETQFIAVTAYQNTDITQLKIDHNPF
  AKGFRDNYDSSHQIVPGGRYGVQSFFPEPFVNTLPQARYYNGERTVPQTNGLLSPQQSEEVANPPQRWLVTPVQQ
  PGTNKLDISSYESEYTSSTLLPYGIKSLPLQTSHALGYYPDPTFPAMAGWGGRGSYQRKMAAGLPWTSRTSPTVF
  SEDQLSKEKVKEEIGSSWIETPPSIKSLDSNDSGVYTSACKRRRLSPSNSSNENSPSIKCEDINAEEYSKDTSKG
  MGGYYAFYTTP

• Structural information:
  • Interpro: IPR008967  IPR032385  IPR036960  IPR001699  IPR018186  
  • Prosite: PS01283 PS01264 PS50252
  • CDD: cd00182
  • STRING: ENSP00000388620
• Other Databases: GeneCards:  EOMES  Malacards:  EOMES

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0001102	RNA polymerase II activating transcription factor binding	IBA	molecular function
GO:0001707	mesoderm formation	IBA	biological process
GO:0001708	cell fate specification	IBA	biological process
GO:0002302	CD8-positive, alpha-beta T cell differentiation involved in immune response	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0000790	nuclear chromatin	IBA	cellular component
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA	molecular function
GO:0001714	endodermal cell fate specification	IBA	biological process
GO:0001947	heart looping	IBA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	ISS	biological process
GO:0060809	mesodermal to mesenchymal transition involved in gastrulation	ISS	biological process
GO:0060706	cell differentiation involved in embryonic placenta development	ISS	biological process
GO:0007420	brain development	IMP	biological process
GO:0003677	DNA binding	ISS	molecular function
GO:0002302	CD8-positive, alpha-beta T cell differentiation involved in immune response	IMP	biological process
GO:0001707	mesoderm formation	ISS	biological process
GO:0001706	endoderm formation	ISS	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0002250	adaptive immune response	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007369	gastrulation	IEA	biological process
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0048382	mesendoderm development	IEA	biological process
GO:0043433	negative regulation of DNA-binding transcription factor activity	IEA	biological process
GO:0032609	interferon-gamma production	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0022008	neurogenesis	IEA	biological process
GO:0021772	olfactory bulb development	IEA	biological process
GO:0010002	cardioblast differentiation	IEA	biological process
GO:0009653	anatomical structure morphogenesis	IEA	biological process
GO:0007492	endoderm development	IEA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0003682	chromatin binding	IEA	molecular function
GO:0001824	blastocyst development	IEA	biological process
GO:0001714	endodermal cell fate specification	IEA	biological process
GO:0060809	mesodermal to mesenchymal transition involved in gastrulation	IEA	biological process
GO:0060706	cell differentiation involved in embryonic placenta development	IEA	biological process
GO:0035914	skeletal muscle cell differentiation	IEA	biological process
GO:0030182	neuron differentiation	IEA	biological process
GO:0021895	cerebral cortex neuron differentiation	IEA	biological process
GO:0021796	cerebral cortex regionalization	IEA	biological process
GO:0019827	stem cell population maintenance	IEA	biological process
GO:0010468	regulation of gene expression	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0002302	CD8-positive, alpha-beta T cell differentiation involved in immune response	IEA	biological process
GO:0001829	trophectodermal cell differentiation	IEA	biological process
GO:0001707	mesoderm formation	IEA	biological process
GO:0001706	endoderm formation	IEA	biological process
GO:0001102	RNA polymerase II activating transcription factor binding	IEA	molecular function
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0000790	nuclear chromatin	IEA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0001102	RNA polymerase II activating transcription factor binding	ISS	molecular function
GO:0043433	negative regulation of DNA-binding transcription factor activity	ISS	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	ISS	biological process
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Polymicrogyria	KEGG:H00271
Polymicrogyria	KEGG:H00271
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq