• Gene id: 832

Gene Summary

• Gene Symbol: CAPZB   Gene   UCSC   Ensembl
• Aliases: CAPB, CAPPB, CAPZ
• Gene name: capping actin protein of muscle Z-line subunit beta
• Alternate names: F-actin-capping protein subunit beta, capZ beta, capping actin protein of muscle Z-line beta subunit, capping protein (actin filament) muscle Z-line, beta, epididymis secretory sperm binding protein,
• Gene location: 1p36.13 (19485538: 19338774)     Exons: 17     NC_000001.11
• Gene summary(Entrez): This gene encodes the beta subunit of the barbed-end actin binding protein, which belongs to the F-actin capping protein family. The capping protein is a heterodimeric actin capping protein that blocks actin filament assembly and disassembly at the fast g
• OMIM: 601572

Protein Summary

• Protein general information: P47756  
  • Name: F actin capping protein subunit beta (CapZ beta)
  • Length: 277  
  • Mass: 31350
• Sequence:

  MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPW
  SNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDS
  IHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIR
  STLNEIYFGKTKDIVNGLRSIDAIPDNQKFKQLQRELSQVLTQRQIYIQPDN

• Structural information:
  • Interpro: IPR037282  IPR042276  IPR001698  IPR019771  
  • Prosite: PS00231
  • STRING: ENSP00000401010
• Other Databases: GeneCards:  CAPZB  Malacards:  CAPZB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051490	negative regulation of filopodium assembly	IBA	biological process
GO:0051016	barbed-end actin filament capping	IBA	biological process
GO:0051015	actin filament binding	IBA	molecular function
GO:0010591	regulation of lamellipodium assembly	IBA	biological process
GO:0008290	F-actin capping protein complex	IBA	cellular component
GO:0000902	cell morphogenesis	IBA	biological process
GO:0071203	WASH complex	IDA	cellular component
GO:0003779	actin binding	IDA	molecular function
GO:0007010	cytoskeleton organization	IMP	biological process
GO:0022604	regulation of cell morphogenesis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0008290	F-actin capping protein complex	IEA	cellular component
GO:0030036	actin cytoskeleton organization	IEA	biological process
GO:0051016	barbed-end actin filament capping	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003779	actin binding	IEA	molecular function
GO:0051693	actin filament capping	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0003779	actin binding	TAS	molecular function
GO:0008290	F-actin capping protein complex	TAS	cellular component
GO:0015629	actin cytoskeleton	TAS	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007596	blood coagulation	TAS	biological process
GO:0045296	cadherin binding	HDA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0030017	sarcomere	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005856	cytoskeleton	TAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R