• Gene id: 8318

Gene Summary

• Gene Symbol: CDC45   Gene   UCSC   Ensembl
• Aliases: CDC45L, CDC45L2, MGORS7, PORC-PI-1
• Gene name: cell division cycle 45
• Alternate names: cell division control protein 45 homolog, CDC45 cell division cycle 45 homolog, CDC45 cell division cycle 45-like, CDC45-related protein, cell division cycle 45 homolog, cell division cycle 45-like 2, human CDC45,
• Gene location: 22q11.21 (19479293: 19520611)     Exons: 21     NC_000022.11
• Gene summary(Entrez): The protein encoded by this gene was identified by its strong similarity with Saccharomyces cerevisiae Cdc45, an essential protein required to the initiation of DNA replication. Cdc45 is a member of the highly conserved multiprotein complex including Cdc6
• OMIM: 603465

Protein Summary

• Protein general information: O75419  
  • Name: Cell division control protein 45 homolog (PORC PI 1)
  • Length: 566  
  • Mass: 65569
  • Tissue specificity: Widely expressed, highest levels are found in adult testis and thymus and in fetal liver.
• Sequence:

  MFVSDFRKEFYEVVQSQRVLLFVASDVDALCACKILQALFQCDHVQYTLVPVSGWQELETAFLEHKEQFHYFILI
  NCGANVDLLDILQPDEDTIFFVCDTHRPVNVVNVYNDTQIKLLIKQDDDLEVPAYEDIFRDEEEDEEHSGNDSDG
  SEPSEKRTRLEEEIVEQTMRRRQRREWEARRRDILFDYEQYEYHGTSSAMVMFELAWMLSKDLNDMLWWAIVGLT
  DQWVQDKITQMKYVTDVGVLQRHVSRHNHRNEDEENTLSVDCTRISFEYDLRLVLYQHWSLHDSLCNTSYTAARF
  KLWSVHGQKRLQEFLADMGLPLKQVKQKFQAMDISLKENLREMIEESANKFGMKDMRVQTFSIHFGFKHKFLASD
  VVFATMSLMESPEKDGSGTDHFIQALDSLSRSNLDKLYHGLELAKKQLRATQQTIASCLCTNLVISQGPFLYCSL
  MEGTPDVMLFSRPASLSLLSKHLLKSFVCSTKNRRCKLLPLVMAAPLSMEHGTVTVVGIPPETDSSDRKNFFGRA
  FEKAAESTSSRMLHNHFDLSVIELKAEDRSKFLDALISLLS

• Structural information:
  • Interpro: IPR003874  
  • PDB: 5DGO
  • PDBsum: 5DGO
  • DIP: 31725
  • STRING: ENSP00000405726
• Other Databases: GeneCards:  CDC45  Malacards:  CDC45

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003682	chromatin binding	IBA	molecular function
GO:0003688	DNA replication origin binding	IBA	molecular function
GO:0005656	nuclear pre-replicative complex	IBA	cellular component
GO:0031298	replication fork protection complex	IBA	cellular component
GO:1900087	positive regulation of G1/S transition of mitotic cell cycle	IBA	biological process
GO:0000727	double-strand break repair via break-induced replication	IBA	biological process
GO:0003697	single-stranded DNA binding	IBA	molecular function
GO:0006270	DNA replication initiation	IBA	biological process
GO:0031261	DNA replication preinitiation complex	IBA	cellular component
GO:0031938	regulation of chromatin silencing at telomere	IBA	biological process
GO:1902977	mitotic DNA replication preinitiation complex assembly	IBA	biological process
GO:0006270	DNA replication initiation	IEA	biological process
GO:0006260	DNA replication	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0006270	DNA replication initiation	TAS	biological process
GO:0000076	DNA replication checkpoint	TAS	biological process
GO:0000083	regulation of transcription involved in G1/S transition of mitotic cell cycle	TAS	biological process
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0036064	ciliary basal body	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04110	Cell cycle

Diseases

Associated diseases	References
Meier-Gorlin syndrome	KEGG:H01889
Meier-Gorlin syndrome	KEGG:H01889
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray