• Gene id: 8317

Gene Summary

• Gene Symbol: CDC7   Gene   UCSC   Ensembl
• Aliases: CDC7L1, HsCDC7, Hsk1, huCDC7
• Gene name: cell division cycle 7
• Alternate names: cell division cycle 7-related protein kinase, CDC7 (cell division cycle 7, S. cerevisiae, homolog)-like 1, CDC7-related kinase, cell division cycle 7 homolog, cell division cycle 7-like protein 1,
• Gene location: 1p22.1 (91498967: 91525763)     Exons: 14     NC_000001.11
• Gene summary(Entrez): This gene encodes a cell division cycle protein with kinase activity that is critical for the G1/S transition. The yeast homolog is also essential for initiation of DNA replication as cell division occurs. Overexpression of this gene product may be associ
• OMIM: 603311

Protein Summary

• Protein general information: O00311  
  • Name: Cell division cycle 7 related protein kinase (CDC7 related kinase) (HsCdc7) (huCdc7) (EC 2.7.11.1)
  • Length: 574  
  • Mass: 63,888
• Sequence:

  MEASLGIQMDEPMAFSPQRDRFQAEGSLKKNEQNFKLAGVKKDIEKLYEAVPQLSNVFKIEDKIGEGTFSSVYLA
  TAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNVMGVKYCFRKNDHVVIAMPYLEHESFLDILNSLS
  FQEVREYMLNLFKALKRIHQFGIVHRDVKPSNFLYNRRLKKYALVDFGLAQGTHDTKIELLKFVQSEAQQERCSQ
  NKSHIITGNKIPLSGPVPKELDQQSTTKASVKRPYTNAQIQIKQGKDGKEGSVGLSVQRSVFGERNFNIHSSISH
  ESPAVKLMKQSKTVDVLSRKLATKKKAISTKVMNSAVMRKTASSCPASLTCDCYATDKVCSICLSRRQQVAPRAG
  TPGFRAPEVLTKCPNQTTAIDMWSAGVIFLSLLSGRYPFYKASDDLTALAQIMTIRGSRETIQAAKTFGKSILCS
  KEVPAQDLRKLCERLRGMDSSTPKLTSDIQGHASHQPAISEKTDHKASCLVQTPPGQYSGNSFKKGDSNSCEHCF
  DEYNTNLEGWNEVPDEAYDLLDKLLDLNPASRITAEEALLHPFFKDMSL

• Structural information:
  • Protein Domains: Protein (58-574)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 4F99 4F9A 4F9B 4F9C 5UWQ 5UWR
  • PDBsum: 4F99 4F9A 4F9B 4F9C 5UWQ 5UWR
  • DIP: 31728
  • STRING: ENSP00000234626
• Other Databases: GeneCards:  CDC7  Malacards:  CDC7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0000727	double-strand break repair via break-induced replication	IBA	biological process
GO:0004672	protein kinase activity	IMP	molecular function
GO:0004672	protein kinase activity	IMP	molecular function
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0006260	DNA replication	TAS	biological process
GO:0006270	DNA replication initiation	IBA	biological process
GO:0006909	phagocytosis	IBA	biological process
GO:0008284	positive regulation of cell proliferation	IMP	biological process
GO:0008360	regulation of cell shape	IBA	biological process
GO:0010571	positive regulation of nuclear cell cycle DNA replication	IMP	biological process
GO:0010971	positive regulation of G2/M transition of mitotic cell cycle	IMP	biological process
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0016301	kinase activity	IDA	molecular function
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0044770	cell cycle phase transition	IMP	biological process
GO:0045171	intercellular bridge	IDA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0000727	double-strand break repair via break-induced replication	IBA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IMP	molecular function
GO:0004672	protein kinase activity	IMP	molecular function
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0006260	DNA replication	TAS	biological process
GO:0006270	DNA replication initiation	IBA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006909	phagocytosis	IBA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0008284	positive regulation of cell proliferation	IMP	biological process
GO:0008360	regulation of cell shape	IBA	biological process
GO:0010571	positive regulation of nuclear cell cycle DNA replication	IMP	biological process
GO:0010971	positive regulation of G2/M transition of mitotic cell cycle	IMP	biological process
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0016301	kinase activity	IEA	molecular function
GO:0016301	kinase activity	IDA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0044770	cell cycle phase transition	IMP	biological process
GO:0045171	intercellular bridge	IDA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0000727	double-strand break repair via break-induced replication	IBA	biological process
GO:0004672	protein kinase activity	IMP	molecular function
GO:0004672	protein kinase activity	IMP	molecular function
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0006260	DNA replication	TAS	biological process
GO:0006270	DNA replication initiation	IBA	biological process
GO:0006909	phagocytosis	IBA	biological process
GO:0008284	positive regulation of cell proliferation	IMP	biological process
GO:0008360	regulation of cell shape	IBA	biological process
GO:0010571	positive regulation of nuclear cell cycle DNA replication	IMP	biological process
GO:0010971	positive regulation of G2/M transition of mitotic cell cycle	IMP	biological process
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0016301	kinase activity	IDA	molecular function
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0044770	cell cycle phase transition	IMP	biological process
GO:0045171	intercellular bridge	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04110	Cell cycle

Diseases

Associated diseases	References
Cancer (head and neck)	GAD: 20819778
Blood pressure	GAD: 17903302
Male factor infertility	MIK: 19426592
Azoospermia	MIK: 19426592
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Assocaited with impaired spermatogenesis	MIK: 14517263
Azoospermia	MIK: 19426592

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
19426592	Azoospermia				Male infertility	CDC10 CDC7L1 CDK9 CDC20 and CLK3
14517263	Assocaited with impaired spermatogenesis				Male infertility
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881