• Gene id: 8315

Gene Summary

• Gene Symbol: BRAP   Gene   UCSC   Ensembl
• Aliases: BRAP2, IMP, RNF52
• Gene name: BRCA1 associated protein
• Alternate names: BRCA1-associated protein, RING finger protein 52, RING-type E3 ubiquitin transferase BRAP2, galectin-2-binding protein, impedes mitogenic signal propagation, renal carcinoma antigen NY-REN-63,
• Gene location: 12q24.12 (111686022: 111642145)     Exons: 13     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene was identified by its ability to bind to the nuclear localization signal of BRCA1 and other proteins. It is a cytoplasmic protein which may regulate nuclear targeting by retaining proteins with a nuclear localization signa
• OMIM: 604986

Protein Summary

• Protein general information: Q7Z569  
  • Name: BRCA1 associated protein (EC 2.3.2.27) (BRAP2) (Impedes mitogenic signal propagation) (IMP) (RING finger protein 52) (RING type E3 ubiquitin transferase BRAP2) (Renal carcinoma antigen NY REN 63)
  • Length: 592  
  • Mass: 67305
  • Tissue specificity: Expressed in breast epithelial cell lines. {ECO
• Sequence:

  MSVSLVVIRLELAEHSPVPAGFGFSAAAGEMSDEEIKKTTLASAVACLEGKSPGEKVAIIHQHLGRREMTDVIIE
  TMKSNPDELKTTVEERKSSEASPTAQRSKDHSKECINAAPDSPSKQLPDQISFFSGNPSVEIVHGIMHLYKTNKM
  TSLKEDVRRSAMLCILTVPAAMTSHDLMKFVAPFNEVIEQMKIIRDSTPNQYMVLIKFRAQADADSFYMTCNGRQ
  FNSIEDDVCQLVYVERAEVLKSEDGASLPVMDLTELPKCTVCLERMDESVNGILTTLCNHSFHSQCLQRWDDTTC
  PVCRYCQTPEPVEENKCFECGVQENLWICLICGHIGCGRYVSRHAYKHFEETQHTYAMQLTNHRVWDYAGDNYVH
  RLVASKTDGKIVQYECEGDTCQEEKIDALQLEYSYLLTSQLESQRIYWENKIVRIEKDTAEEINNMKTKFKETIE
  KCDNLEHKLNDLLKEKQSVERKCTQLNTKVAKLTNELKEEQEMNKCLRANQVLLQNKLKEEERVLKETCDQKDLQ
  ITEIQEQLRDVMFYLETQQKINHLPAETRQEIQEGQINIAMASASSPASSGGSGKLPSRKGRSKRGK

• Structural information:
  • Interpro: IPR011422  IPR034932  IPR035979  IPR001841  IPR013083   IPR001607  
  • Prosite: PS50089 PS50271
  • CDD: cd12718
  • STRING: ENSP00000403524
• Other Databases: GeneCards:  BRAP  Malacards:  BRAP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008270	zinc ion binding	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0008139	nuclear localization sequence binding	IDA	molecular function
GO:0007265	Ras protein signal transduction	IDA	biological process
GO:0000151	ubiquitin ligase complex	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0000165	MAPK cascade	IDA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:0000165	MAPK cascade	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0061630	ubiquitin protein ligase activity	TAS	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0009968	negative regulation of signal transduction	IDA	biological process
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04014	Ras signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray