• Gene id: 8313

Gene Summary

• Gene Symbol: AXIN2   Gene   UCSC   Ensembl
• Aliases: AXIL, ODCRCS
• Gene name: axin 2
• Alternate names: axin-2, axin-like protein, axis inhibition protein 2, conductin,
• Gene location: 17q24.1 (65561647: 65528562)     Exons: 15     NC_000017.11
• Gene summary(Entrez): The Axin-related protein, Axin2, presumably plays an important role in the regulation of the stability of beta-catenin in the Wnt signaling pathway, like its rodent homologs, mouse conductin/rat axil. In mouse, conductin organizes a multiprotein complex o

Protein Summary

• Protein general information: Q9Y2T1  
  • Name: Axin 2 (Axin like protein) (Axil) (Axis inhibition protein 2) (Conductin)
  • Length: 843  
  • Mass: 93558
  • Tissue specificity: Expressed in brain and lymphoblast.
• Sequence:

  MSSAMLVTCLPDPSSSFREDAPRPPVPGEEGETPPCQPGVGKGQVTKPMSVSSNTRRNEDGLGEPEGRASPDSPL
  TRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQMNLKDTKTLRVAKAIYKRYIENNSIVSKQLK
  PATKTYIRDGIKKQQIDSIMFDQAQTEIQSVMEENAYQMFLTSDIYLEYVRSGGENTAYMSNGGLGSLKVVCGYL
  PTLNEEEEWTCADFKCKLSPTVVGLSSKTLRATASVRSTETVDSGYRSFKRSDPVNPYHIGSGYVFAPATSANDS
  EISSDALTDDSMSMTDSSVDGIPPYRVGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPKEMTPVEPATFAAELI
  SRLEKLKLELESRHSLEERLQQIREDEEREGSELTLNSREGAPTQHPLSLLPSGSYEEDPQTILDDHLSRVLKTP
  GCQSPGVGRYSPRSRSPDHHHHHHSQYHSLLPPGGKLPPAAASPGACPLLGGKGFVTKQTTKHVHHHYIHHHAVP
  KTKEEIEAEATQRVHCFCPGGSEYYCYSKCKSHSKAPETMPSEQFGGSRGSTLPKRNGKGTEPGLALPAREGGAP
  GGAGALQLPREEGDRSQDVWQWMLESERQSKPKPHSAQSTKKAYPLESARSSPGERASRHHLWGGNSGHPRTTPR
  AHLFTQDPAMPPLTPPNTLAQLEEACRRLAEVSKPPKQRCCVASQQRDRNHSATVQTGATPFSNPSLAPEDHKEP
  KKLAGVHALQASELVVTYFFCGEEIPYRRMLKAQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWEDE
  TVLPMYEGRILGKVERID

• Structural information:
  • Protein Domains: (81..20-)
    (/note="RGS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00171-)
    (761..84-)
    (/note="DIX-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00069"-)
  • Interpro: IPR014936  IPR032101  IPR001158  IPR038207  IPR016137   IPR036305  IPR024066  IPR029071  
  • Prosite: PS50841 PS50132
  • CDD: cd11582
  • DIP: 59293
  • STRING: ENSP00000302625
• Other Databases: GeneCards:  AXIN2  Malacards:  AXIN2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0090263	positive regulation of canonical Wnt signaling pathway	TAS	biological process
GO:1904837	beta-catenin-TCF complex assembly	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070602	regulation of centromeric sister chromatid cohesion	IEA	biological process
GO:0061181	regulation of chondrocyte development	IEA	biological process
GO:0031625	ubiquitin protein ligase binding	IEA	molecular function
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0005813	centrosome	IEA	cellular component
GO:0003139	secondary heart field specification	IEA	biological process
GO:0001957	intramembranous ossification	IEA	biological process
GO:0070411	I-SMAD binding	IEA	molecular function
GO:0045668	negative regulation of osteoblast differentiation	IEA	biological process
GO:0030282	bone mineralization	IEA	biological process
GO:0030111	regulation of Wnt signaling pathway	IEA	biological process
GO:0008283	cell population proliferation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003413	chondrocyte differentiation involved in endochondral bone morphogenesis	IEA	biological process
GO:0001756	somitogenesis	IEA	biological process
GO:0008013	beta-catenin binding	NAS	molecular function
GO:0005813	centrosome	IDA	cellular component
GO:0008285	negative regulation of cell population proliferation	IMP	biological process
GO:0070602	regulation of centromeric sister chromatid cohesion	IMP	biological process
GO:0034613	cellular protein localization	IDA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IDA	biological process
GO:0001934	positive regulation of protein phosphorylation	IMP	biological process
GO:0010718	positive regulation of epithelial to mesenchymal transition	IMP	biological process
GO:0010942	positive regulation of cell death	IMP	biological process
GO:0030877	beta-catenin destruction complex	NAS	cellular component
GO:0032423	regulation of mismatch repair	IMP	biological process
GO:0042476	odontogenesis	IMP	biological process
GO:0042476	odontogenesis	IMP	biological process
GO:0043570	maintenance of DNA repeat elements	IMP	biological process
GO:0048255	mRNA stabilization	IMP	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IMP	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IMP	biological process
GO:0005737	cytoplasm	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05010	Alzheimer disease
hsa05165	Human papillomavirus infection
hsa04310	Wnt signaling pathway
hsa04390	Hippo signaling pathway
hsa05225	Hepatocellular carcinoma
hsa04934	Cushing syndrome
hsa05226	Gastric cancer
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa05224	Breast cancer
hsa05210	Colorectal cancer
hsa05217	Basal cell carcinoma
hsa05213	Endometrial cancer

Diseases

Associated diseases	References
Medulloblastoma	KEGG:H01667
Oligodontia-colorectal cancer syndrome	KEGG:H00857
Medulloblastoma	KEGG:H01667
Oligodontia-colorectal cancer syndrome	KEGG:H00857
Endometrial adenocarcinoma	PMID:11940574
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881