• Gene id: 8310

Gene Summary

• Gene Symbol: ACOX3   Gene   UCSC   Ensembl
• Gene name: acyl-CoA oxidase 3, pristanoyl
• Alternate names: peroxisomal acyl-coenzyme A oxidase 3, BRCACox, acyl-Coenzyme A oxidase 3, pristanoyl, branched-chain acyl-CoA oxidase, pristanoyl-CoA oxidase,
• Gene location: 4p16.1 (8440722: 8366262)     Exons: 22     NC_000004.12
• Gene summary(Entrez): Acyl-Coenzyme A oxidase 3 also know as pristanoyl -CoA oxidase (ACOX3)is involved in the desaturation of 2-methyl branched fatty acids in peroxisomes. Unlike the rat homolog, the human gene is expressed in very low amounts in liver such that its mRNA was
• OMIM: 603402

Protein Summary

• Protein general information: O15254  
  • Name: Peroxisomal acyl coenzyme A oxidase 3 (EC 1.3.3.6) (Branched chain acyl CoA oxidase) (BRCACox) (Pristanoyl CoA oxidase)
  • Length: 700  
  • Mass: 77629
• Sequence:

  MASTVEGGDTALLPEFPRGPLDAYRARASFSWKELALFTEGEGMLRFKKTIFSALENDPLFARSPGADLSLEKYR
  ELNFLRCKRIFEYDFLSVEDMFKSPLKVPALIQCLGMYDSSLAAKYLLHSLVFGSAVYSSGSERHLTYIQKIFRM
  EIFGCFALTELSHGSNTKAIRTTAHYDPATEEFIIHSPDFEAAKFWVGNMGKTATHAVVFAKLCVPGDQCHGLHP
  FIVQIRDPKTLLPMPGVMVGDIGKKLGQNGLDNGFAMFHKVRVPRQSLLNRMGDVTPEGTYVSPFKDVRQRFGAS
  LGSLSSGRVSIVSLAILNLKLAVAIALRFSATRRQFGPTEEEEIPVLEYPMQQWRLLPYLAAVYALDHFSKSLFL
  DLVELQRGLASGDRSARQAELGREIHALASASKPLASWTTQQGIQECREACGGHGYLAMNRLGVLRDDNDPNCTY
  EGDNNILLQQTSNYLLGLLAHQVHDGACFRSPLKSVDFLDAYPGILDQKFEVSSVADCLDSAVALAAYKWLVCYL
  LRETYQKLNQEKRSGSSDFEARNKCQVSHGRPLALAFVELTVVQRFHEHVHQPSVPPSLRAVLGRLSALYALWSL
  SRHAALLYRGGYFSGEQAGEVLESAVLALCSQLKDDAVALVDVIAPPDFVLDSPIGRADGELYKNLWGAVLQESK
  VLERASWWPEFSVNKPVIGSLKSKL

• Structural information:
  • Interpro: IPR034171  IPR006091  IPR012258  IPR002655  IPR036250   IPR009100  
  • CDD: cd01150
  • STRING: ENSP00000348775
• Other Databases: GeneCards:  ACOX3  Malacards:  ACOX3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003997	acyl-CoA oxidase activity	IBA	molecular function
GO:0005504	fatty acid binding	IBA	molecular function
GO:0016402	pristanoyl-CoA oxidase activity	IBA	molecular function
GO:0033540	fatty acid beta-oxidation using acyl-CoA oxidase	IBA	biological process
GO:0050660	flavin adenine dinucleotide binding	IBA	molecular function
GO:0005777	peroxisome	IBA	cellular component
GO:0055088	lipid homeostasis	IBA	biological process
GO:0003997	acyl-CoA oxidase activity	IEA	molecular function
GO:0006635	fatty acid beta-oxidation	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0071949	FAD binding	IEA	molecular function
GO:0005777	peroxisome	IEA	cellular component
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0016627	oxidoreductase activity, acting on the CH-CH group of donors	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005777	peroxisome	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0003997	acyl-CoA oxidase activity	IEA	molecular function
GO:0005782	peroxisomal matrix	TAS	cellular component
GO:0005782	peroxisomal matrix	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006625	protein targeting to peroxisome	TAS	biological process
GO:0033540	fatty acid beta-oxidation using acyl-CoA oxidase	TAS	biological process
GO:0005777	peroxisome	IEA	cellular component
GO:0033540	fatty acid beta-oxidation using acyl-CoA oxidase	IEA	biological process
GO:0005777	peroxisome	IDA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04024	cAMP signaling pathway
hsa01200	Carbon metabolism
hsa04146	Peroxisome
hsa03320	PPAR signaling pathway
hsa01212	Fatty acid metabolism
hsa00071	Fatty acid degradation
hsa00410	beta-Alanine metabolism
hsa00640	Propanoate metabolism
hsa01040	Biosynthesis of unsaturated fatty acids
hsa00592	alpha-Linolenic acid metabolism

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq