• Gene id: 8303

Gene Summary

• Gene Symbol: SNN   Gene   UCSC   Ensembl
• Gene name: stannin
• Alternate names: stannin, AG8_1,
• Gene location: 16p13.13 (11668454: 11679153)     Exons: 4     NC_000016.10
• OMIM: 601641

Protein Summary

• Protein general information: O75324  
  • Name: Stannin (AG8_1)
  • Length: 88  
  • Mass: 9497
• Sequence:

  MSIMDHSPTTGVVTVIVILIAIAALGALILGCWCYLRLQRISQSEDEESIVGDGETKEPFLLVQYSAKGPCVERK
  AKLMTPNGPEVHG

• Structural information:
  • Interpro: IPR015137  IPR015136  IPR015135  IPR038747  IPR027435  
  • PDB: 1ZZA
  • PDBsum: 1ZZA
  • STRING: ENSP00000329287
• Other Databases: GeneCards:  SNN  Malacards:  SNN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IBA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0009636	response to toxic substance	TAS	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0016021	integral component of membrane	IDA	cellular component
GO:0046872	metal ion binding	IDA	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq