• Gene id: 830

Gene Summary

• Gene Symbol: CAPZA2   Gene   UCSC   Ensembl
• Aliases: CAPPA2, CAPZ
• Gene name: capping actin protein of muscle Z-line subunit alpha 2
• Alternate names: F-actin-capping protein subunit alpha-2, F-actin capping protein alpha-2 subunit, capZ alpha-2, capping actin protein of muscle Z-line alpha subunit 2, capping protein (actin filament) muscle Z-line, alpha 2, epididymis secretory sperm binding protein,
• Gene location: 7q31.2 (116862586: 116922048)     Exons: 10     NC_000007.14
• Gene summary(Entrez): The protein encoded by this gene is a member of the F-actin capping protein alpha subunit family. It is the alpha subunit of the barbed-end actin binding protein Cap Z. By capping the barbed end of actin filaments, Cap Z regulates the growth of the actin
• OMIM: 604469

Protein Summary

• Protein general information: P47755  
  • Name: F actin capping protein subunit alpha 2 (CapZ alpha 2)
  • Length: 286  
  • Mass: 32949
• Sequence:

  MADLEEQLSDEEKVRIAAKFIIHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNLDQFTPVKIEGYEDQVL
  ITEHGDLGNGKFLDPKNRICFKFDHLRKEATDPRPCEVENAVESWRTSVETALRAYVKEHYPNGVCTVYGKKIDG
  QQTIIACIESHQFQAKNFWNGRWRSEWKFTITPSTTQVVGILKIQVHYYEDGNVQLVSHKDIQDSLTVSNEVQTA
  KEFIKIVEAAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA

• Structural information:
  • Interpro: IPR002189  IPR037282  IPR042276  IPR042489  IPR017865  
  • Prosite: PS00748 PS00749
  • STRING: ENSP00000354947
• Other Databases: GeneCards:  CAPZA2  Malacards:  CAPZA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051016	barbed-end actin filament capping	IBA	biological process
GO:0051015	actin filament binding	IBA	molecular function
GO:0030036	actin cytoskeleton organization	IBA	biological process
GO:0008290	F-actin capping protein complex	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0008290	F-actin capping protein complex	IEA	cellular component
GO:0051016	barbed-end actin filament capping	IEA	biological process
GO:0051693	actin filament capping	IEA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0065003	protein-containing complex assembly	TAS	biological process
GO:0008290	F-actin capping protein complex	TAS	cellular component
GO:0015629	actin cytoskeleton	TAS	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007596	blood coagulation	TAS	biological process
GO:0045087	innate immune response	TAS	biological process
GO:0008290	F-actin capping protein complex	IEA	cellular component
GO:0005903	brush border	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0030863	cortical cytoskeleton	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray