• Gene id: 8288

Gene Summary

• Gene Symbol: EPX   Gene   UCSC   Ensembl
• Aliases: EPO, EPP, EPX-PEN, EPXD
• Gene name: eosinophil peroxidase
• Alternate names: eosinophil peroxidase,
• Gene location: 17q22 (58192725: 58205173)     Exons: 13     NC_000017.11
• Gene summary(Entrez): This gene is a member of the peroxidase gene family and is expressed in eosinophils. The encoded preproprotein is proteolytically processed into covalently attached heavy and light chains to form the mature enzyme, which functions as an oxidant. The enzym
• OMIM: 131399

Protein Summary

• Protein general information: P11678  
  • Name: Eosinophil peroxidase (EPO) (EC 1.11.1.7) [Cleaved into: Eosinophil peroxidase light chain; Eosinophil peroxidase heavy chain]
  • Length: 715  
  • Mass: 81040
• Sequence:

  MHLLPALAGVLATLVLAQPCEGTDPASPGAVETSVLRDCIAEAKLLVDAAYNWTQKSIKQRLRSGSASPMDLLSY
  FKQPVAATRTVVRAADYMHVALGLLEEKLQPQRSGPFNVTDVLTEPQLRLLSQASGCALRDQAERCSDKYRTITG
  RCNNKRRPLLGASNQALARWLPAEYEDGLSLPFGWTPSRRRNGFLLPLVRAVSNQIVRFPNERLTSDRGRALMFM
  QWGQFIDHDLDFSPESPARVAFTAGVDCERTCAQLPPCFPIKIPPNDPRIKNQRDCIPFFRSAPSCPQNKNRVRN
  QINALTSFVDASMVYGSEVSLSLRLRNRTNYLGLLAINQRFQDNGRALLPFDNLHDDPCLLTNRSARIPCFLAGD
  TRSTETPKLAAMHTLFMREHNRLATELRRLNPRWNGDKLYNEARKIMGAMVQIITYRDFLPLVLGKARARRTLGH
  YRGYCSNVDPRVANVFTLAFRFGHTMLQPFMFRLDSQYRASAPNSHVPLSSAFFASWRIVYEGGIDPILRGLMAT
  PAKLNRQDAMLVDELRDRLFRQVRRIGLDLAALNMQRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNQDLAR
  KFLNLYGTPDNIDIWIGAIAEPLLPGARVGPLLACLFENQFRRARDGDRFWWQKRGVFTKRQRKALSRISLSRII
  CDNTGITTVSRDIFRANIYPRGFVNCSRIPRLNLSAWRGT

• Structural information:
  • Interpro: IPR029599  IPR019791  IPR010255  IPR037120  
  • Prosite: PS00435 PS50292
  • STRING: ENSP00000225371
• Other Databases: GeneCards:  EPX  Malacards:  EPX

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042742	defense response to bacterium	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0004601	peroxidase activity	IBA	molecular function
GO:0004601	peroxidase activity	IEA	molecular function
GO:0006952	defense response	IEA	biological process
GO:0020037	heme binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0006979	response to oxidative stress	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0004601	peroxidase activity	IEA	molecular function
GO:0042744	hydrogen peroxide catabolic process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0004601	peroxidase activity	TAS	molecular function
GO:0004601	peroxidase activity	IEA	molecular function
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0034774	secretory granule lumen	TAS	cellular component
GO:0032753	positive regulation of interleukin-4 production	IEA	biological process
GO:0004601	peroxidase activity	IEA	molecular function
GO:0002215	defense response to nematode	IEA	biological process
GO:0072677	eosinophil migration	IEA	biological process
GO:0032714	negative regulation of interleukin-5 production	IEA	biological process
GO:0032693	negative regulation of interleukin-10 production	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05310	Asthma

Diseases

Associated diseases	References
Eosinophil peroxidase deficiency	KEGG:H01094
Eosinophil peroxidase deficiency	KEGG:H01094
Asthma	PMID:20813885
Allergic asthma	PMID:11846868
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq