• Gene id: 8273

Gene Summary

• Gene Symbol: SLC10A3   Gene   UCSC   Ensembl
• Aliases: DXS253E, P3
• Gene name: solute carrier family 10 member 3
• Alternate names: P3 protein, Protein P3, solute carrier family 10 (sodium/bile acid cotransporter family), member 3,
• Gene location: Xq28 (154490655: 154487309)     Exons: 5     NC_000023.11
• Gene summary(Entrez): This gene maps to a GC-rich region of the X chromosome and was identified by its proximity to a CpG island. It is thought to be a housekeeping gene. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSe
• OMIM: 300028

Protein Summary

• Protein general information: P09131  
  • Name: P3 protein (Solute carrier family 10 member 3)
  • Length: 477  
  • Mass: 50333
• Sequence:

  MVLMQDKGSSQQWPGLGGEGGGTGPLSMLRAALLLISLPWGAQGTASTSLSTAGGHTVPPTGGRYLSIGDGSVME
  FEFPEDSEGIIVISSQYPGQANRTAPGPMLRVTSLDTEVLTIKNVSAITWGGGGGFVVSIHSGLAGLAPLHIQLV
  DAHEAPPTLIEERRDFCIKVSPAEDTPATLSADLAHFSENPILYLLLPLIFVNKCSFGCKVELEVLKGLMQSPQP
  MLLGLLGQFLVMPLYAFLMAKVFMLPKALALGLIITCSSPGGGGSYLFSLLLGGDVTLAISMTFLSTVAATGFLP
  LSSAIYSRLLSIHETLHVPISKILGTLLFIAIPIAVGVLIKSKLPKFSQLLLQVVKPFSFVLLLGGLFLAYRMGV
  FILAGIRLPIVLVGITVPLVGLLVGYCLATCLKLPVAQRRTVSIEVGVQNSLLALAMLQLSLRRLQADYASQAPF
  IVALSGTSEMLALVIGHFIYSSLFPVP

• Structural information:
  • Interpro: IPR002657  IPR004710  IPR038770  IPR030210  
  • STRING: ENSP00000263512
• Other Databases: GeneCards:  SLC10A3  Malacards:  SLC10A3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008508	bile acid:sodium symporter activity	IBA	molecular function
GO:0015721	bile acid and bile salt transport	IBA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0015293	symporter activity	IEA	molecular function
GO:0010033	response to organic substance	IEA	biological process
GO:0032526	response to retinoic acid	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0008508	bile acid:sodium symporter activity	IBA	molecular function
GO:0015721	bile acid and bile salt transport	IBA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0015293	symporter activity	IEA	molecular function
GO:0010033	response to organic substance	IEA	biological process
GO:0032526	response to retinoic acid	IEA	biological process
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881