• Gene id: 8260

Gene Summary

• Gene Symbol: NAA10   Gene   UCSC   Ensembl
• Aliases: ARD1, ARD1A, ARD1P, DXS707, MCOPS1, NATD, OGDNS, TE2, hARD1
• Gene name: N-alpha-acetyltransferase 10, NatA catalytic subunit
• Alternate names: N-alpha-acetyltransferase 10, ARD1 homolog A, N-acetyltransferase, N-acetyltransferase ARD1, human homolog of, N-terminal acetyltransferase complex ARD1 subunit homolog A, arrest defective protein 1, natA catalytic subunit Naa10,
• Gene location: Xq28 (153935036: 153929224)     Exons: 8     NC_000023.11
• Gene summary(Entrez): N-alpha-acetylation is among the most common post-translational protein modifications in eukaryotic cells. This process involves the transfer of an acetyl group from acetyl-coenzyme A to the alpha-amino group on a nascent polypeptide and is essential for

Protein Summary

• Protein general information: P41227  
  • Name: N alpha acetyltransferase 10 (EC 2.3.1.255) (N terminal acetyltransferase complex ARD1 subunit homolog A) (hARD1) (NatA catalytic subunit Naa10)
  • Length: 235  
  • Mass: 26459
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSL
  AVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRD
  LTQMADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVK
  DSSEASDSAS

• Structural information:
  • Protein Domains: (1..15-)
    (/note="N-acetyltransferase-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00532"-)
  • Interpro: IPR016181  IPR000182  
  • Prosite: PS51186
  • PDB: 6C95 6C9M
  • PDBsum: 6C95 6C9M
  • STRING: ENSP00000417763
• Other Databases: GeneCards:  NAA10  Malacards:  NAA10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:1990190	peptide-glutamate-N-acetyltransferase activity	IBA	molecular function
GO:0006474	N-terminal protein amino acid acetylation	IBA	biological process
GO:0004596	peptide alpha-N-acetyltransferase activity	IBA	molecular function
GO:1990189	peptide-serine-N-acetyltransferase activity	IBA	molecular function
GO:0031415	NatA complex	IBA	cellular component
GO:0018002	N-terminal peptidyl-glutamic acid acetylation	IBA	biological process
GO:0017198	N-terminal peptidyl-serine acetylation	IBA	biological process
GO:0006474	N-terminal protein amino acid acetylation	IDA	biological process
GO:0004596	peptide alpha-N-acetyltransferase activity	IDA	molecular function
GO:0006473	protein acetylation	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:2000719	negative regulation of maintenance of mitotic sister chromatid cohesion, centromeric	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008080	N-acetyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0008080	N-acetyltransferase activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0006475	internal protein amino acid acetylation	TAS	biological process
GO:0006323	DNA packaging	TAS	biological process
GO:0005622	intracellular	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0008080	N-acetyltransferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006474	N-terminal protein amino acid acetylation	IDA	biological process
GO:0004596	peptide alpha-N-acetyltransferase activity	IDA	contributes to
GO:0043022	ribosome binding	IDA	contributes to
GO:0031415	NatA complex	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006474	N-terminal protein amino acid acetylation	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0043022	ribosome binding	IDA	contributes to
GO:0016407	acetyltransferase activity	IDA	contributes to
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Microphthalmia, syndromic	KEGG:H02170
Microphthalmia, syndromic	KEGG:H02170
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881