• Gene id: 824

Gene Summary

• Gene Symbol: CAPN2   Gene   UCSC   Ensembl
• Aliases: CANP2, CANPL2, CANPml, mCANP
• Gene name: calpain 2
• Alternate names: calpain-2 catalytic subunit, CANP 2, M-calpain, calcium-activated neutral proteinase 2, calpain 2, (m/II) large subunit, calpain 2, large [catalytic] subunit, calpain 2, large subunit, calpain M-type, calpain, large polypeptide L2, millimolar-calpain,
• Gene location: 1q41 (223701592: 223776017)     Exons: 22     NC_000001.11
• Gene summary(Entrez): The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct
• OMIM: 114230

Protein Summary

• Protein general information: P17655  
  • Name: Calpain 2 catalytic subunit (EC 3.4.22.53) (Calcium activated neutral proteinase 2) (CANP 2) (Calpain M type) (Calpain large polypeptide L2) (Calpain 2 large subunit) (Millimolar calpain) (M calpain)
  • Length: 700  
  • Mass: 79995
  • Tissue specificity: Ubiquitous.
• Sequence:

  MAGIAAKLAKDREAAEGLGSHDRAIKYLNQDYEALRNECLEAGTLFQDPSFPAIPSALGFKELGPYSSKTRGIEW
  KRPTEICADPQFIIGGATRTDICQGALGDCWLLAAIASLTLNEEILARVVPLNQSFQENYAGIFHFQFWQYGEWV
  EVVVDDRLPTKDGELLFVHSAEGSEFWSALLEKAYAKINGCYEALSGGATTEGFEDFTGGIAEWYELKKPPPNLF
  KIIQKALQKGSLLGCSIDITSAADSEAITFQKLVKGHAYSVTGAEEVESNGSLQKLIRIRNPWGEVEWTGRWNDN
  CPSWNTIDPEERERLTRRHEDGEFWMSFSDFLRHYSRLEICNLTPDTLTSDTYKKWKLTKMDGNWRRGSTAGGCR
  NYPNTFWMNPQYLIKLEEEDEDEEDGESGCTFLVGLIQKHRRRQRKMGEDMHTIGFGIYEVPEELSGQTNIHLSK
  NFFLTNRARERSDTFINLREVLNRFKLPPGEYILVPSTFEPNKDGDFCIRVFSEKKADYQAVDDEIEANLEEFDI
  SEDDIDDGFRRLFAQLAGEDAEISAFELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLDSDGSGKLGLKEFYIL
  WTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKMPCQLHQVIVARFADDQLIIDFDNFVRCLVRLETLFKI
  FKQLDPENTGTIELDLISWLCFSVL

• Structural information:
  • Protein Domains: (45..34-)
    (/note="Calpain-catalytic)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00239-)
    (572..60-)
    (/note="EF-hand-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (602..63-)
    (/note="EF-hand-2)
    (/evidence="ECO:0000255|PROSITE-Pro-)
  • Interpro: IPR033883  IPR022684  IPR022682  IPR022683  IPR036213   IPR029539  IPR011992  IPR018247  IPR002048  IPR042736  IPR038765  IPR000169  IPR001300  
  • Prosite: PS50203 PS00018 PS50222 PS00139
  • CDD: cd00214 cd00044 cd16199
  • PDB: 1KFU 1KFX 2NQA
  • PDBsum: 1KFU 1KFX 2NQA
  • STRING: ENSP00000295006
• Other Databases: GeneCards:  CAPN2  Malacards:  CAPN2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0006508	proteolysis	IBA	NOT|biological process
GO:0006508	proteolysis	IBA	biological process
GO:0071230	cellular response to amino acid stimulus	ISS	biological process
GO:0071230	cellular response to amino acid stimulus	ISS	biological process
GO:0030425	dendrite	ISS	cellular component
GO:0006508	proteolysis	ISS	biological process
GO:0006508	proteolysis	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0004198	calcium-dependent cysteine-type endopeptidase activity	ISS	molecular function
GO:0004198	calcium-dependent cysteine-type endopeptidase activity	ISS	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0051493	regulation of cytoskeleton organization	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0008234	cysteine-type peptidase activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071230	cellular response to amino acid stimulus	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0001824	blastocyst development	IEA	biological process
GO:2001247	positive regulation of phosphatidylcholine biosynthetic process	IEA	biological process
GO:0071230	cellular response to amino acid stimulus	IEA	biological process
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0010666	positive regulation of cardiac muscle cell apoptotic process	IEA	biological process
GO:0008092	cytoskeletal protein binding	IEA	molecular function
GO:0007565	female pregnancy	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005509	calcium ion binding	IEA	molecular function
GO:0001666	response to hypoxia	IEA	biological process
GO:0007520	myoblast fusion	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000785	chromatin	IEA	cellular component
GO:1901741	positive regulation of myoblast fusion	IEA	biological process
GO:1901216	positive regulation of neuron death	IEA	biological process
GO:0048266	behavioral response to pain	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0043025	neuronal cell body	IEA	cellular component
GO:0042542	response to hydrogen peroxide	IEA	biological process
GO:0035458	cellular response to interferon-beta	IEA	biological process
GO:0032675	regulation of interleukin-6 production	IEA	biological process
GO:0019899	enzyme binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0005758	mitochondrial intermembrane space	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0045121	membrane raft	IDA	cellular component
GO:0045121	membrane raft	IDA	colocalizes with
GO:0051603	proteolysis involved in cellular protein catabolic process	IDA	biological process
GO:0097038	perinuclear endoplasmic reticulum	IDA	cellular component
GO:0004198	calcium-dependent cysteine-type endopeptidase activity	IDA	molecular function
GO:0008092	cytoskeletal protein binding	NAS	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0031143	pseudopodium	IDA	cellular component
GO:0051493	regulation of cytoskeleton organization	TAS	biological process
GO:0030864	cortical actin cytoskeleton	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005925	focal adhesion	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa05131	Shigellosis
hsa04510	Focal adhesion
hsa04141	Protein processing in endoplasmic reticulum
hsa04217	Necroptosis
hsa04218	Cellular senescence
hsa04210	Apoptosis

Diseases

Associated diseases	References
Alzheimer's disease	PMID:9654354
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq