• Gene id: 823

Gene Summary

• Gene Symbol: CAPN1   Gene   UCSC   Ensembl
• Aliases: CANP, CANP1, CANPL1, SPG76, muCANP, muCL
• Gene name: calpain 1
• Alternate names: calpain-1 catalytic subunit, CANP 1, calcium-activated neutral proteinase 1, calpain 1, (mu/I) large subunit, calpain mu-type, calpain, large polypeptide L1, calpain-1 large subunit, cell proliferation-inducing gene 30 protein, cell proliferation-inducing protein,
• Gene location: 11q13.1 (65181372: 65212005)     Exons: 25     NC_000011.10
• Gene summary(Entrez): The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct
• OMIM: 601123

Protein Summary

• Protein general information: P07384  
  • Name: Calpain 1 catalytic subunit (EC 3.4.22.52) (Calcium activated neutral proteinase 1) (CANP 1) (Calpain mu type) (Calpain 1 large subunit) (Cell proliferation inducing gene 30 protein) (Micromolar calpain) (muCANP)
  • Length: 714  
  • Mass: 81890
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MSEEIITPVYCTGVSAQVQKQRARELGLGRHENAIKYLGQDYEQLRVRCLQSGTLFRDEAFPPVPQSLGYKDLGP
  NSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAAIASLTLNDTLLHRVVPHGQSFQNGYAGIFH
  FQLWQFGEWVDVVVDDLLPIKDGKLVFVHSAEGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWY
  ELRKAPSDLYQIILKALERGSLLGCSIDISSVLDMEAITFKKLVKGHAYSVTGAKQVNYRGQVVSLIRMRNPWGE
  VEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLEICNLTPDALKSRTIRKWNTTLYEGTW
  RRGSTAGGCRNYPATFWVNPQFKIRLDETDDPDDYGDRESGCSFVLALMQKHRRRERRFGRDMETIGFAVYEVPP
  ELVGQPAVHLKRDFFLANASRARSEQFINLREVSTRFRLPPGEYVVVPSTFEPNKEGDFVLRFFSEKSAGTVELD
  DQIQANLPDEQVLSEEEIDENFKALFRQLAGEDMEISVKELRTILNRIISKHKDLRTKGFSLESCRSMVNLMDRD
  GNGKLGLVEFNILWNRIRNYLSIFRKFDLDKSGSMSAYEMRMAIESAGFKLNKKLYELIITRYSEPDLAVDFDNF
  VCCLVRLETMFRFFKTLDTDLDGVVTFDLFKWLQLTMFA

• Structural information:
  • Protein Domains: (55..35-)
    (/note="Calpain-catalytic)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00239-)
    (541..57-)
    (/note="EF-hand-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (585..61-)
    (/note="EF-hand-2)
    (/evidence="ECO:0000255|PROSITE-Pro-)
  • Interpro: IPR033883  IPR022684  IPR022682  IPR022683  IPR036213   IPR029643  IPR011992  IPR018247  IPR002048  IPR038765  IPR000169  IPR001300  
  • Prosite: PS50203 PS00018 PS50222 PS00139
  • CDD: cd00214 cd00044
  • PDB: 1ZCM 2ARY
  • PDBsum: 1ZCM 2ARY
  • STRING: ENSP00000431984
• Other Databases: GeneCards:  CAPN1  Malacards:  CAPN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004198	calcium-dependent cysteine-type endopeptidase activity	TAS	molecular function
GO:2000310	regulation of NMDA receptor activity	TAS	biological process
GO:0016241	regulation of macroautophagy	NAS	biological process
GO:0006508	proteolysis	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0006508	proteolysis	IDA	biological process
GO:0006508	proteolysis	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005509	calcium ion binding	IDA	molecular function
GO:0097264	self proteolysis	IDA	biological process
GO:0097264	self proteolysis	IDA	biological process
GO:0006508	proteolysis	IDA	biological process
GO:0004198	calcium-dependent cysteine-type endopeptidase activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0050790	regulation of catalytic activity	IDA	biological process
GO:0050790	regulation of catalytic activity	IDA	biological process
GO:0006508	proteolysis	ISS	biological process
GO:0004198	calcium-dependent cysteine-type endopeptidase activity	ISS	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0004198	calcium-dependent cysteine-type endopeptidase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0008284	positive regulation of cell population proliferation	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904813	ficolin-1-rich granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0070268	cornification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0004198	calcium-dependent cysteine-type endopeptidase activity	IEA	molecular function
GO:0060056	mammary gland involution	IEA	biological process
GO:0032801	receptor catabolic process	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006508	proteolysis	IDA	biological process
GO:0004198	calcium-dependent cysteine-type endopeptidase activity	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005925	focal adhesion	HDA	cellular component
GO:0004198	calcium-dependent cysteine-type endopeptidase activity	TAS	molecular function
GO:2000310	regulation of NMDA receptor activity	TAS	biological process
GO:0016241	regulation of macroautophagy	NAS	biological process
GO:0006508	proteolysis	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0006508	proteolysis	IDA	biological process
GO:0006508	proteolysis	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005509	calcium ion binding	IDA	molecular function
GO:0097264	self proteolysis	IDA	biological process
GO:0097264	self proteolysis	IDA	biological process
GO:0006508	proteolysis	IDA	biological process
GO:0004198	calcium-dependent cysteine-type endopeptidase activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0050790	regulation of catalytic activity	IDA	biological process
GO:0050790	regulation of catalytic activity	IDA	biological process
GO:0006508	proteolysis	ISS	biological process
GO:0004198	calcium-dependent cysteine-type endopeptidase activity	ISS	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0004198	calcium-dependent cysteine-type endopeptidase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0008284	positive regulation of cell population proliferation	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904813	ficolin-1-rich granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0070268	cornification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0004198	calcium-dependent cysteine-type endopeptidase activity	IEA	molecular function
GO:0060056	mammary gland involution	IEA	biological process
GO:0032801	receptor catabolic process	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006508	proteolysis	IDA	biological process
GO:0004198	calcium-dependent cysteine-type endopeptidase activity	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005925	focal adhesion	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa05131	Shigellosis
hsa04141	Protein processing in endoplasmic reticulum
hsa04217	Necroptosis
hsa04218	Cellular senescence
hsa04210	Apoptosis

Diseases

Associated diseases	References
Hereditary spastic paraplegia	KEGG:H00266
Hereditary spastic paraplegia	KEGG:H00266
Alzheimer's disease	PMID:11231011
Alzheimer's disease	PMID:8622780
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray