About Us

Search Result


Gene id 8226
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol PUDP   Gene   UCSC   Ensembl
Aliases DXF68S1E, FAM16AX, GS1, HDHD1, HDHD1A
Gene name pseudouridine 5'-phosphatase
Alternate names pseudouridine-5'-phosphatase, 5'-PsiMPase, family with sequence similarity 16, member A, X-linked, haloacid dehalogenase-like hydrolase domain containing 1, haloacid dehalogenase-like hydrolase domain containing 1A, haloacid dehalogenase-like hydrolase domain-,
Gene location Xp22.31 (7148152: 6768839)     Exons: 9     NC_000023.11
Gene summary(Entrez) This gene encodes a member of the haloacid dehalogenase-like (HAD) hydrolase superfamily. The encoded protein has no known biological function. This gene has a pseudogene on chromosome 1. Multiple alternatively spliced transcript variants encoding differe
OMIM 601041

Protein Summary

Protein general information Q08623  

Name: Pseudouridine 5' phosphatase (EC 3.1.3.96) (Haloacid dehalogenase like hydrolase domain containing protein 1) (Haloacid dehalogenase like hydrolase domain containing protein 1A) (Protein GS1) (Pseudouridine 5' monophosphatase) (5' PsiMPase)

Length: 228  Mass: 25249

Sequence MAAPPQPVTHLIFDMDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAAQIIIDVLQLPMSKEELV
EESQTKLKEVFPTAALMPGAEKLIIHLRKHGIPFALATSSGSASFDMKTSRHKEFFSLFSHIVLGDDPEVQHGKP
DPDIFLACAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGLP
SYE
Structural information
Interpro:  IPR036412  IPR006439  IPR041492  IPR023214  IPR023198  

PDB:  
3L5K
PDBsum:   3L5K
STRING:   ENSP00000396452
Other Databases GeneCards:  PUDP  Malacards:  PUDP

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0000287 magnesium ion binding
IBA molecular function
GO:0016791 phosphatase activity
IBA molecular function
GO:0016787 hydrolase activity
IEA molecular function
GO:0016787 hydrolase activity
IEA molecular function
GO:0046872 metal ion binding
IEA molecular function
GO:0009117 nucleotide metabolic proc
ess
IEA biological process
GO:1990738 pseudouridine 5'-phosphat
ase activity
IEA molecular function
GO:0043097 pyrimidine nucleoside sal
vage
TAS biological process
GO:0005829 cytosol
TAS cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0016311 dephosphorylation
IEA biological process
GO:0016311 dephosphorylation
IEA biological process
GO:0008150 biological_process
ND biological process
GO:0003674 molecular_function
ND molecular function
GO:0000287 magnesium ion binding
IBA molecular function
GO:0016791 phosphatase activity
IBA molecular function
GO:0016787 hydrolase activity
IEA molecular function
GO:0016787 hydrolase activity
IEA molecular function
GO:0046872 metal ion binding
IEA molecular function
GO:0009117 nucleotide metabolic proc
ess
IEA biological process
GO:1990738 pseudouridine 5'-phosphat
ase activity
IEA molecular function
GO:0043097 pyrimidine nucleoside sal
vage
TAS biological process
GO:0005829 cytosol
TAS cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0016311 dephosphorylation
IEA biological process
GO:0016311 dephosphorylation
IEA biological process
GO:0008150 biological_process
ND biological process
GO:0003674 molecular_function
ND molecular function
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Unexplained infertility MIK: 25753583

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract
25753583 Unexplaine
d infertil
ity

46 (17 fertile
men, 29 male pa
tients)
Male infertility Microarray
Show abstract