• Gene id: 822

Gene Summary

• Gene Symbol: CAPG   Gene   UCSC   Ensembl
• Aliases: AFCP, HEL-S-66, MCP
• Gene name: capping actin protein, gelsolin like
• Alternate names: macrophage-capping protein, actin-regulatory protein CAP-G, capping protein (actin filament), gelsolin-like, epididymis secretory protein Li 66, gelsolin-like capping protein,
• Gene location: 2p11.2 (85418466: 85394747)     Exons: 15     NC_000002.12
• Gene summary(Entrez): This gene encodes a member of the gelsolin/villin family of actin-regulatory proteins. The encoded protein reversibly blocks the barbed ends of F-actin filaments in a Ca2+ and phosphoinositide-regulated manner, but does not sever preformed actin filaments
• OMIM: 609713

SNPs

rs11703684

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000022.11   g.24748945C>G
NC_000022.11   g.24748945C>T
NC_000022.10   g.25144912C>G
NC_000022.10   g.25144912C>T
NM_001008496.3   c.1411G>C
NM_001008496.3   c.1411G>A
NR_045648.1   n.2042G>C
NR_045648.1   n.2042G>A
NR_045649.1   n.1915A>G
NR_045649.1   n.1915A>C
NM_0  

rs3747052

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000022.11   g.19131479A>G
NC_000022.11   g.19131479A>T
NC_000022.10   g.19118992A>G
NC_000022.10   g.19118992A>T
NG_008320.1   g.18199T>C
NG_008320.1   g.18199T>A
NM_022719.3   c.*2717T>C
NM_022719.3   c.*2717T>A
NM_022719.2   c.*2717T>C
NM_022719.2   c.*2717T>A
NR_1  

rs1052756

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000022.11   g.19132173C>T
NC_000022.10   g.19119686C>T
NG_008320.1   g.17505G>A
NM_022719.3   c.*2023G>A
NM_022719.2   c.*2023G>A
NR_134304.2   n.3542G>A
NR_134304.1   n.3568G>A
NM_053006.5   c.774C>T
NM_053006.4   c.774C>T|SEQ=[C/T]|GENE=ESS2
TSSK2   23617

rs1052763

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000022.11   g.19132238C>T
NC_000022.10   g.19119751C>T
NG_008320.1   g.17440G>A
NM_022719.3   c.*1958G>A
NM_022719.2   c.*1958G>A
NR_134304.2   n.3477G>A
NR_134304.1   n.3503G>A
NM_053006.5   c.839C>T
NM_053006.4   c.839C>T
NP_443732.3   p.Thr280Met|SEQ=[C/T]|GENE=ES

rs1052773

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000022.11   g.19132425G>A
NC_000022.10   g.19119938G>A
NG_008320.1   g.17253C>T
NM_022719.3   c.*1771C>T
NM_022719.2   c.*1771C>T
NR_134304.2   n.3290C>T
NR_134304.1   n.3316C>T
NM_053006.5   c.1026G>A
NM_053006.4   c.1026G>A|SEQ=[G/A]|GENE=ESS2
TSSK2   23617

Protein Summary

• Protein general information: P40121  
  • Name: Macrophage capping protein (Actin regulatory protein CAP G)
  • Length: 348  
  • Mass: 38499
  • Tissue specificity: Macrophages and macrophage-like cells.
• Sequence:

  MYTAIPQSGSPFPGSVQDPGLHVWRVEKLKPVPVAQENQGVFFSGDSYLVLHNGPEEVSHLHLWIGQQSSRDEQG
  ACAVLAVHLNTLLGERPVQHREVQGNESDLFMSYFPRGLKYQEGGVESAFHKTSTGAPAAIKKLYQVKGKKNIRA
  TERALNWDSFNTGDCFILDLGQNIFAWCGGKSNILERNKARDLALAIRDSERQGKAQVEIVTDGEEPAEMIQVLG
  PKPALKEGNPEEDLTADKANAQAAALYKVSDATGQMNLTKVADSSPFALELLISDDCFVLDNGLCGKIYIWKGRK
  ANEKERQAALQVAEGFISRMQYAPNTQVEILPQGHESPIFKQFFKDWK

• Structural information:
  • Interpro: IPR029006  IPR029917  IPR007123  IPR007122  
  • PDB: 1J72 1JHW
  • PDBsum: 1J72 1JHW
  • DIP: 61547
  • STRING: ENSP00000263867
• Other Databases: GeneCards:  CAPG  Malacards:  CAPG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051016	barbed-end actin filament capping	IBA	biological process
GO:0051015	actin filament binding	IBA	molecular function
GO:0030031	cell projection assembly	IBA	biological process
GO:0015629	actin cytoskeleton	IBA	cellular component
GO:0008154	actin polymerization or depolymerization	IBA	biological process
GO:0007417	central nervous system development	IBA	biological process
GO:0051014	actin filament severing	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding	IBA	molecular function
GO:0051015	actin filament binding	IEA	molecular function
GO:0051016	barbed-end actin filament capping	IEA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0051693	actin filament capping	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0065003	protein-containing complex assembly	NAS	biological process
GO:0008290	F-actin capping protein complex	TAS	cellular component
GO:0051016	barbed-end actin filament capping	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0045296	cadherin binding	HDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0042470	melanosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component
GO:0001726	ruffle	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005814	centriole	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0072686	mitotic spindle	IDA	cellular component
GO:0044877	protein-containing complex binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0090543	Flemming body	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0022617	extracellular matrix disassembly	IMP	NOT|biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0071803	positive regulation of podosome assembly	IMP	NOT|biological process
GO:0005515	protein binding	IPI	molecular function
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0051016	barbed-end actin filament capping	IBA	biological process
GO:0051015	actin filament binding	IBA	molecular function
GO:0030031	cell projection assembly	IBA	biological process
GO:0015629	actin cytoskeleton	IBA	cellular component
GO:0008154	actin polymerization or depolymerization	IBA	biological process
GO:0007417	central nervous system development	IBA	biological process
GO:0051014	actin filament severing	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding	IBA	molecular function
GO:0051015	actin filament binding	IEA	molecular function
GO:0051016	barbed-end actin filament capping	IEA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0051693	actin filament capping	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0065003	protein-containing complex assembly	NAS	biological process
GO:0008290	F-actin capping protein complex	TAS	cellular component
GO:0051016	barbed-end actin filament capping	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0045296	cadherin binding	HDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0042470	melanosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component
GO:0001726	ruffle	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005814	centriole	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0072686	mitotic spindle	IDA	cellular component
GO:0044877	protein-containing complex binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0090543	Flemming body	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0022617	extracellular matrix disassembly	IMP	NOT|biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0071803	positive regulation of podosome assembly	IMP	NOT|biological process
GO:0005515	protein binding	IPI	molecular function
GO:0019904	protein domain specific binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881