• Gene id: 8204

Gene Summary

• Gene Symbol: NRIP1   Gene   UCSC   Ensembl
• Aliases: RIP140
• Gene name: nuclear receptor interacting protein 1
• Alternate names: nuclear receptor-interacting protein 1, nuclear factor RIP140, receptor-interacting protein 140,
• Gene location: 21q11.2-q21.1 (15065902: 14961234)     Exons: 10     NC_000021.9
• Gene summary(Entrez): Nuclear receptor interacting protein 1 (NRIP1) is a nuclear protein that specifically interacts with the hormone-dependent activation domain AF2 of nuclear receptors. Also known as RIP140, this protein modulates transcriptional activity of the estrogen re
• OMIM: 602490

Protein Summary

• Protein general information: P48552  
  • Name: Nuclear receptor interacting protein 1 (Nuclear factor RIP140) (Receptor interacting protein 140)
  • Length: 1158  
  • Mass: 126,942
  • Tissue specificity: Testis. {ECO
• Sequence:

  MTHGEELGSDVHQDSIVLTYLEGLLMHQAAGGSGTAVDKKSAGHNEEDQNFNISGSAFPTCQSNGPVLNTHTYQG
  SGMLHLKKARLLQSSEDWNAAKRKRLSDSIMNLNVKKEALLAGMVDSVPKGKQDSTLLASLLQSFSSRLQTVALS
  QQIRQSLKEQGYALSHDSLKVEKDLRCYGVASSHLKTLLKKSKVKDQKPDTNLPDVTKNLIRDRFAESPHHVGQS
  GTKVMSEPLSCAARLQAVASMVEKRASPATSPKPSVACSQLALLLSSEAHLQQYSREHALKTQNANQAASERLAA
  MARLQENGQKDVGSYQLPKGMSSHLNGQARTSSSKLMASKSSATVFQNPMGIIPSSPKNAGYKNSLERNNIKQAA
  NNSLLLHLLKSQTIPKPMNGHSHSERGSIFEESSTPTTIDEYSDNNPSFTDDSSGDESSYSNCVPIDLSCKHRTE
  KSESDQPVSLDNFTQSLLNTWDPKVPDVDIKEDQDTSKNSKLNSHQKVTLLQLLLGHKNEENVEKNTSPQGVHND
  VSKFNTQNYARTSVIESPSTNRTTPVSTPPLLTSSKAGSPINLSQHSLVIKWNSPPYVCSTQSEKLTNTASNHSM
  DLTKSKDPPGEKPAQNEGAQNSATFSASKLLQNLAQCGMQSSMSVEEQRPSKQLLTGNTDKPIGMIDRLNSPLLS
  NKTNAVEENKAFSSQPTGPEPGLSGSEIENLLERRTVLQLLLGNPNKGKSEKKEKTPLRDESTQEHSERALSEQI
  LMVKIKSEPCDDLQIPNTNVHLSHDAKSAPFLGMAPAVQRSAPALPVSEDFKSEPVSPQDFSFSKNGLLSRLLRQ
  NQDSYLADDSDRSHRNNEMALLESKNLCMVPKKRKLYTEPLENPFKKMKNNIVDAANNHSAPEVLYGSLLNQEEL
  KFSRNDLEFKYPAGHGSASESEHRSWARESKSFNVLKQLLLSENCVRDLSPHRSNSVADSKKKGHKNNVTNSKPE
  FSISSLNGLMYSSTQPSSCMDNRTFSYPGVVKTPVSPTFPEHLGCAGSRPESGLLNGCSMPSEKGPIKWVITDAE
  KNEYEKDSPRLTKTNPILYYMLQKGGNSVTSRETQDKDIWREASSAESVSQVTAKEELLPTAETKASFFNLRSPY
  NSHMGNNASRPHSANGEVYGLLGSVLTIKKESE

• Structural information:
  • Interpro: IPR026649  IPR031405  IPR031406  IPR031407  IPR031408  
  • PDB: 2GPO 2GPP 4S14 4S15 5NTI 5NTN 5NTW 5NU1
  • PDBsum: 2GPO 2GPP 4S14 4S15 5NTI 5NTN 5NTW 5NU1
  • DIP: 5964
  • STRING: ENSP00000327213
• Other Databases: GeneCards:  NRIP1  Malacards:  NRIP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000118	histone deacetylase complex	IEA	cellular component
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0001046	core promoter sequence-specific DNA binding	IDA	molecular function
GO:0001543	ovarian follicle rupture	IEA	biological process
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0003713	transcription coactivator activity	NAS	molecular function
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0003714	transcription corepressor activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0007623	circadian rhythm	IEP	biological process
GO:0016607	nuclear speck	IEA	cellular component
GO:0019915	lipid storage	IEA	biological process
GO:0030054	cell junction	IDA	cellular component
GO:0030331	estrogen receptor binding	IPI	molecular function
GO:0030521	androgen receptor signaling pathway	NAS	biological process
GO:0032922	circadian regulation of gene expression	IMP	biological process
GO:0035257	nuclear hormone receptor binding	IPI	molecular function
GO:0035259	glucocorticoid receptor binding	IPI	molecular function
GO:0035259	glucocorticoid receptor binding	IPI	molecular function
GO:0035259	glucocorticoid receptor binding	IPI	molecular function
GO:0042826	histone deacetylase binding	IEA	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	NAS	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0046965	retinoid X receptor binding	IEA	molecular function
GO:0050681	androgen receptor binding	NAS	molecular function
GO:0071392	cellular response to estradiol stimulus	IDA	biological process
GO:0000118	histone deacetylase complex	IEA	cellular component
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0001046	core promoter sequence-specific DNA binding	IDA	molecular function
GO:0001543	ovarian follicle rupture	IEA	biological process
GO:0003712	transcription cofactor activity	IEA	molecular function
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0003713	transcription coactivator activity	NAS	molecular function
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0003714	transcription corepressor activity	IEA	molecular function
GO:0003714	transcription corepressor activity	IDA	molecular function
GO:0005102	receptor binding	IEA	molecular function
GO:0005102	receptor binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006357	regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0006357	regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0007623	circadian rhythm	IEP	biological process
GO:0016607	nuclear speck	IEA	cellular component
GO:0019915	lipid storage	IEA	biological process
GO:0030054	cell junction	IDA	cellular component
GO:0030331	estrogen receptor binding	IEA	molecular function
GO:0030331	estrogen receptor binding	IPI	molecular function
GO:0030521	androgen receptor signaling pathway	NAS	biological process
GO:0030728	ovulation	IEA	biological process
GO:0032922	circadian regulation of gene expression	IEA	biological process
GO:0032922	circadian regulation of gene expression	IMP	biological process
GO:0035257	nuclear hormone receptor binding	IPI	molecular function
GO:0035259	glucocorticoid receptor binding	IPI	molecular function
GO:0035259	glucocorticoid receptor binding	IPI	molecular function
GO:0035259	glucocorticoid receptor binding	IPI	molecular function
GO:0042826	histone deacetylase binding	IEA	molecular function
GO:0042974	retinoic acid receptor binding	IEA	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	NAS	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0046965	retinoid X receptor binding	IEA	molecular function
GO:0048511	rhythmic process	IEA	biological process
GO:0050681	androgen receptor binding	NAS	molecular function
GO:0071392	cellular response to estradiol stimulus	IDA	biological process
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0001046	core promoter sequence-specific DNA binding	IDA	molecular function
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0003713	transcription coactivator activity	NAS	molecular function
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0003714	transcription corepressor activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0007623	circadian rhythm	IEP	biological process
GO:0030054	cell junction	IDA	cellular component
GO:0030331	estrogen receptor binding	IPI	molecular function
GO:0030521	androgen receptor signaling pathway	NAS	biological process
GO:0032922	circadian regulation of gene expression	IMP	biological process
GO:0035257	nuclear hormone receptor binding	IPI	molecular function
GO:0035259	glucocorticoid receptor binding	IPI	molecular function
GO:0035259	glucocorticoid receptor binding	IPI	molecular function
GO:0035259	glucocorticoid receptor binding	IPI	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	NAS	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0050681	androgen receptor binding	NAS	molecular function
GO:0071392	cellular response to estradiol stimulus	IDA	biological process

Diseases

Associated diseases	References
Cancer (esophageal)	GAD: 20453000
Cancer	GAD: 18950845
Cancer (breast)	GAD: 18950845
Cancer (epithelial ovarian)	GAD: 19064572
Crohn's disease	GAD: 18587394
Ulcerative colitis	GAD: 20228799
Ulcerative colitis	GAD: 20228799
Migraine disorder	GAD: 19093296
Cognitive function	GAD: 19734545
Polycystic ovary syndrome (PCOS)	INFBASE: 19887821
Male factor infertility	MIK: 16213843
Oligozoospermia	MIK: 16213843
Endometriosis	GAD: 16131398
Associated with fertility period	MIK: 23173577
Azoospermia	MIK: 16213843
Azoospermia	MIK: 16213843
Oligozoospermia	MIK: 16213843
Cryptorchidism	MIK: 28606200
Male infertility	MIK: 16213843
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
16213843	Azoospermia, Oligozoospermia	ESR1 g.938T>C, FSHR Ser680Asn, ESR2 *39A>G, CYP19A1 *19C>T, and NRIP1 Gly75Gly polymorphism	Spanish	199 (104 men with azoospermia or severe oligozoospermia, 95 healthy controls)	Male infertility	ESR1 FSHR ESR2 CYP19A1 NRIP1
16213843	Azoospermia, oligospermia	ESR1 g.938T>C, FSHR Ser680Asn, ESR2 *39A>G, CYP19A1 *19C>T, and NRIP1 Gly75Gly	Spanish	199 (104 men with azoospermia or severe oligozoospermia, 95 race-matched healthy controls)	Male infertility	ESR1 FSHR ESR2 CYP19A1 and NRIP1
16213843	Male idiopathic infertility	ESR1 g.938T>C, FSHR Ser680Asn, ESR2 *39A>G, CYP19A1*19C>T, and NRIP1 Gly75Gly polymorphism	Spanish	199 (104 with azoospermia or severe oligozoospermia, 95 unselected race-matched healthy controls)	Male infertility	ESR1 FSHR ESR2  CYP19A1 and NRIP1
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq