• Gene id: 8202

Gene Summary

• Gene Symbol: NCOA3   Gene   UCSC   Ensembl
• Aliases: ACTR, AIB-1, AIB1, CAGH16, CTG26, KAT13B, RAC3, SRC-3, SRC3, TNRC14, TNRC16, TRAM-1, bHLHe42, pCIP
• Gene name: nuclear receptor coactivator 3
• Alternate names: nuclear receptor coactivator 3, CBP-interacting protein, amplified in breast cancer 1 protein, class E basic helix-loop-helix protein 42, receptor-associated coactivator 3, steroid receptor coactivator protein 3, thyroid hormone receptor activator molecule 1,
• Gene location: 20q13.12 (18522069: 18442662)     Exons: 16     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene is a nuclear receptor coactivator that interacts with nuclear hormone receptors to enhance their transcriptional activator functions. The encoded protein has histone acetyltransferase activity and recruits p300/CBP-associa
• OMIM: 601937

Protein Summary

• Protein general information: Q9Y6Q9  
  • Name: Nuclear receptor coactivator 3 (NCoA 3) (EC 2.3.1.48) (ACTR) (Amplified in breast cancer 1 protein) (AIB 1) (CBP interacting protein) (pCIP) (Class E basic helix loop helix protein 42) (bHLHe42) (Receptor associated coactivator 3) (RAC 3) (Steroid recepto
  • Length: 1424  
  • Mass: 155293
  • Tissue specificity: Widely expressed. High expression in heart, skeletal muscle, pancreas and placenta. Low expression in brain, and very low in lung, liver and kidney.
• Sequence:

  MSGLGENLDPLASDSRKRKLPCDTPGQGLTCSGEKRRREQESKYIEELAELISANLSDIDNFNVKPDKCAILKET
  VRQIRQIKEQGKTISNDDDVQKADVSSTGQGVIDKDSLGPLLLQALDGFLFVVNRDGNIVFVSENVTQYLQYKQE
  DLVNTSVYNILHEEDRKDFLKNLPKSTVNGVSWTNETQRQKSHTFNCRMLMKTPHDILEDINASPEMRQRYETMQ
  CFALSQPRAMMEEGEDLQSCMICVARRITTGERTFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRRC
  IQRFFSLNDGQSWSQKRHYQEAYLNGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTNDRHGFVSTHFLQREQNG
  YRPNPNPVGQGIRPPMAGCNSSVGGMSMSPNQGLQMPSSRAYGLADPSTTGQMSGARYGGSSNIASLTPGPGMQS
  PSSYQNNNYGLNMSSPPHGSPGLAPNQQNIMISPRNRGSPKIASHQFSPVAGVHSPMASSGNTGNHSFSSSSLSA
  LQAISEGVGTSLLSTLSSPGPKLDNSPNMNITQPSKVSNQDSKSPLGFYCDQNPVESSMCQSNSRDHLSDKESKE
  SSVEGAENQRGPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDSSCKESSVSVTSPSGVSSSTSGGVSSTSNMHG
  SLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSITSCGDGNVVKQEQLSPKKKENNALLRYLLDRDDPSDA
  LSKELQPQVEGVDNKMSQCTSSTIPSSSQEKDPKIKTETSEEGSGDLDNLDAILGDLTSSDFYNNSISSNGSHLG
  TKQQVFQGTNSLGLKSSQSVQSIRPPYNRAVSLDSPVSVGSSPPVKNISAFPMLPKQPMLGGNPRMMDSQENYGS
  SMGGPNRNVTVTQTPSSGDWGLPNSKAGRMEPMNSNSMGRPGGDYNTSLPRPALGGSIPTLPLRSNSIPGARPVL
  QQQQQMLQMRPGEIPMGMGANPYGQAAASNQLGSWPDGMLSMEQVSHGTQNRPLLRNSLDDLVGPPSNLEGQSDE
  RALLDQLHTLLSNTDATGLEEIDRALGIPELVNQGQALEPKQDAFQGQEAAVMMDQKAGLYGQTYPAQGPPMQGG
  FHLQGQSPSFNSMMNQMNQQGNFPLQGMHPRANIMRPRTNTPKQLRMQLQQRLQGQQFLNQSRQALELKMENPTA
  GGAAVMRPMMQPQVSSQQGFLNAQMVAQRSRELLSHHFRQQRVAMMMQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
  QTQAFSPPPNVTASPSMDGLLAGPTMPQAPPQQFPYQPNYGMGQQPDPAFGRVSSPPNAMMSSRMGPSQNPMMQH
  PQAASIYQSSEMKGWPSGNLARNSSFSQQQFAHQGNPAVYSMVHMNGSSGHMGQMNMNPMPMSGMPMGPDQKYC

• Structural information:
  • Protein Domains: (25..8-)
    (/note="bHLH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00981-)
    (110..18-)
    (/note="PAS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00140"-)
  • Interpro: IPR011598  IPR010011  IPR032565  IPR036638  IPR028818   IPR009110  IPR014920  IPR037077  IPR017426  IPR000014  IPR035965  IPR013767  IPR014935  
  • Prosite: PS50888 PS50112
  • CDD: cd00083 cd00130
  • PDB: 1KBH 3L3X 3L3Z 6ES7
  • PDBsum: 1KBH 3L3X 3L3Z 6ES7
  • DIP: 30876
  • STRING: ENSP00000361066
• Other Databases: GeneCards:  NCOA3  Malacards:  NCOA3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0016922	nuclear receptor binding	IBA	molecular function
GO:0030374	nuclear receptor transcription coactivator activity	IBA	molecular function
GO:0032870	cellular response to hormone stimulus	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0035257	nuclear hormone receptor binding	IBA	molecular function
GO:0016922	nuclear receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000993	RNA polymerase II complex binding	ISS	molecular function
GO:2000035	regulation of stem cell division	ISS	biological process
GO:1902459	positive regulation of stem cell population maintenance	ISS	biological process
GO:0043697	cell dedifferentiation	ISS	biological process
GO:0035257	nuclear hormone receptor binding	IEA	molecular function
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0030374	nuclear receptor transcription coactivator activity	IEA	molecular function
GO:0046983	protein dimerization activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004402	histone acetyltransferase activity	IEA	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0071392	cellular response to estradiol stimulus	IDA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016573	histone acetylation	IEA	biological process
GO:0016573	histone acetylation	IEA	biological process
GO:0097718	disordered domain specific binding	IPI	molecular function
GO:0032991	protein-containing complex	IMP	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0035257	nuclear hormone receptor binding	IDA	molecular function
GO:0004402	histone acetyltransferase activity	IDA	molecular function
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0032991	protein-containing complex	IDA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:2001141	regulation of RNA biosynthetic process	IMP	biological process
GO:0045618	positive regulation of keratinocyte differentiation	IMP	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0047485	protein N-terminus binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003713	transcription coactivator activity	IMP	molecular function
GO:0045618	positive regulation of keratinocyte differentiation	IMP	biological process
GO:0035624	receptor transactivation	TAS	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0046966	thyroid hormone receptor binding	NAS	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05224	Breast cancer
hsa04919	Thyroid hormone signaling pathway
hsa04915	Estrogen signaling pathway
hsa01522	Endocrine resistance

Diseases

Associated diseases	References
Prostate cancer	PMID:20166126
Breast carcinoma	PMID:12725419
obesity	PMID:14557830
Associated with spermatogenesis and epigenetic regulation	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Associated with spermatogenesis and epigenetic regulation			18	Male infertility	GSE26881