• Gene id: 81930

Gene Summary

• Gene Symbol: KIF18A   Gene   UCSC   Ensembl
• Aliases: MS-KIF18A, PPP1R99
• Gene name: kinesin family member 18A
• Alternate names: kinesin-like protein KIF18A, protein phosphatase 1, regulatory subunit 99,
• Gene location: 11p14.1 (28108179: 28020618)     Exons: 18     NC_000011.10
• Gene summary(Entrez): KIF18A is a member of the kinesin superfamily of microtubule-associated molecular motors (see MIM 148760) that use hydrolysis of ATP to produce force and movement along microtubules (Luboshits and Benayahu, 2005 [PubMed 15878648]).[supplied by OMIM, Aug 2
• OMIM: 604010

Protein Summary

• Protein general information: Q8NI77  
  • Name: Kinesin like protein KIF18A (Marrow stromal KIF18A) (MS KIF18A)
  • Length: 898  
  • Mass: 102281
• Sequence:

  MSVTEEDLCHHMKVVVRVRPENTKEKAAGFHKVVHVVDKHILVFDPKQEEVSFFHGKKTTNQNVIKKQNKDLKFV
  FDAVFDETSTQSEVFEHTTKPILRSFLNGYNCTVLAYGATGAGKTHTMLGSADEPGVMYLTMLHLYKCMDEIKEE
  KICSTAVSYLEVYNEQIRDLLVNSGPLAVREDTQKGVVVHGLTLHQPKSSEEILHLLDNGNKNRTQHPTDMNATS
  SRSHAVFQIYLRQQDKTASINQNVRIAKMSLIDLAGSERASTSGAKGTRFVEGTNINRSLLALGNVINALADSKR
  KNQHIPYRNSKLTRLLKDSLGGNCQTIMIAAVSPSSVFYDDTYNTLKYANRAKDIKSSLKSNVLNVNNHITQYVK
  ICNEQKAEILLLKEKLKAYEEQKAFTNENDQAKLMISNPQEKEIERFQEILNCLFQNREEIRQEYLKLEMLLKEN
  ELKSFYQQQCHKQIEMMCSEDKVEKATGKRDHRLAMLKTRRSYLEKRREEELKQFDENTNWLHRVEKEMGLLSQN
  GHIPKELKKDLHCHHLHLQNKDLKAQIRHMMDLACLQEQQHRQTEAVLNALLPTLRKQYCTLKEAGLSNAAFESD
  FKEIEHLVERKKVVVWADQTAEQPKQNDLPGISVLMTFPQLGPVQPIPCCSSSGGTNLVKIPTEKRTRRKLMPSP
  LKGQHTLKSPPSQSVQLNDSLSKELQPIVYTPEDCRKAFQNPSTVTLMKPSSFTTSFQAISSNINSDNCLKMLCE
  VAIPHNRRKECGQEDLDSTFTICEDIKSSKCKLPEQESLPNDNKDILQRLDPSSFSTKHSMPVPSMVPSYMAMTT
  AAKRKRKLTSSTSNSSLTADVNSGFAKRVRQDNSSEKHLQENKPTMEHKRNICKINPSMVRKFGRNISKGNLR

• Structural information:
  • Protein Domains: (11..35-)
    (/note="Kinesin-motor)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00283"-)
  • Interpro: IPR027640  IPR019821  IPR001752  IPR036961  IPR027417  
  • Prosite: PS00411 PS50067
  • PDB: 3LRE 5OAM 5OCU 5OGC
  • PDBsum: 3LRE 5OAM 5OCU 5OGC
  • STRING: ENSP00000263181
• Other Databases: GeneCards:  KIF18A  Malacards:  KIF18A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042995	cell projection	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0005874	microtubule	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	TAS	biological process
GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007018	microtubule-based movement	TAS	biological process
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000776	kinetochore	IEA	cellular component
GO:0007080	mitotic metaphase plate congression	IEA	biological process
GO:0007140	male meiotic nuclear division	IEA	biological process
GO:0072520	seminiferous tubule development	IEA	biological process
GO:1990023	mitotic spindle midzone	IEA	cellular component
GO:0071392	cellular response to estradiol stimulus	IEA	biological process
GO:0070507	regulation of microtubule cytoskeleton organization	IEA	biological process
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0001726	ruffle	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:1990023	mitotic spindle midzone	IBA	cellular component
GO:0061673	mitotic spindle astral microtubule	IBA	cellular component
GO:0008017	microtubule binding	IBA	molecular function
GO:0007019	microtubule depolymerization	IBA	biological process
GO:0007018	microtubule-based movement	IBA	biological process
GO:0005871	kinesin complex	IBA	cellular component
GO:0003777	microtubule motor activity	IBA	molecular function
GO:0016887	ATPase activity	IBA	molecular function
GO:0008574	ATP-dependent microtubule motor activity, plus-end-directed	IBA	molecular function
GO:0005874	microtubule	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0000070	mitotic sister chromatid segregation	IBA	biological process
GO:0070463	tubulin-dependent ATPase activity	IDA	molecular function
GO:0008017	microtubule binding	IDA	molecular function
GO:0007080	mitotic metaphase plate congression	IDA	biological process
GO:0007019	microtubule depolymerization	IDA	biological process
GO:0005901	caveola	IDA	cellular component
GO:0005828	kinetochore microtubule	IDA	cellular component
GO:0001726	ruffle	IDA	cellular component
GO:0051010	microtubule plus-end binding	IDA	molecular function
GO:0008574	ATP-dependent microtubule motor activity, plus-end-directed	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003779	actin binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003777	microtubule motor activity	IEA	molecular function
GO:0007018	microtubule-based movement	IEA	biological process
GO:0008017	microtubule binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function

Diseases

Associated diseases	References
Stomach cancer	PMID:27215532
colorectal cancer	PMID:21213216
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R