• Gene id: 8193

Gene Summary

• Gene Symbol: DPF1   Gene   UCSC   Ensembl
• Aliases: BAF45b, NEUD4, neuro-d4
• Gene name: double PHD fingers 1
• Alternate names: zinc finger protein neuro-d4, BRG1-associated factor 45B, D4, zinc and double PHD fingers family 1, neuro-d4 homolog,
• Gene location: 19q13.2 (135954982: 135946903)     Exons: 4     NC_000005.10
• OMIM: 601670

Protein Summary

• Protein general information: Q92782  
  • Name: Zinc finger protein neuro d4 (BRG1 associated factor 45B) (BAF45B) (D4, zinc and double PHD fingers family 1)
  • Length: 380  
  • Mass: 42502
• Sequence:

  MGGLSARPTAGRTDPAGTCWGQDPGSKMATVIPGPLSLGEDFYREAIEHCRSYNARLCAERSLRLPFLDSQTGVA
  QNNCYIWMEKTHRGPGLAPGQIYTYPARCWRKKRRLNILEDPRLRPCEYKIDCEAPLKKEGGLPEGPVLEALLCA
  ETGEKKIELKEEETIMDCQKQQLLEFPHDLEVEDLEDDIPRRKNRAKGKAYGIGGLRKRQDTASLEDRDKPYVCD
  KFYKELAWVPEAQRKHTAKKAPDGTVIPNGYCDFCLGGSKKTGCPEDLISCADCGRSGHPSCLQFTVNMTAAVRT
  YRWQCIECKSCSLCGTSENDGASWAGLTPQDQLLFCDDCDRGYHMYCLSPPMAEPPEGSWSCHLCLRHLKEKASA
  YITLT

• Structural information:
  • Interpro: IPR038046  IPR025750  IPR011011  IPR001965  IPR019787   IPR013083  
  • Prosite: PS01359 PS50016
• Other Databases: GeneCards:  DPF1  Malacards:  DPF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045892	negative regulation of transcription, DNA-templated	IBA	biological process
GO:0042393	histone binding	IBA	molecular function
GO:0004402	histone acetyltransferase activity	IBA	molecular function
GO:0071565	nBAF complex	IBA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0007399	nervous system development	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0000790	nuclear chromatin	IBA	cellular component
GO:0000123	histone acetyltransferase complex	IBA	cellular component
GO:0071565	nBAF complex	ISS	cellular component
GO:0007399	nervous system development	ISS	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0071565	nBAF complex	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0007399	nervous system development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006915	apoptotic process	TAS	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0071565	nBAF complex	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016573	histone acetylation	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04714	Thermogenesis
hsa05225	Hepatocellular carcinoma

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq