• Gene id: 81890

Gene Summary

• Gene Symbol: QTRT1   Gene   UCSC   Ensembl
• Aliases: FP3235, TGT, TGUT
• Gene name: queuine tRNA-ribosyltransferase catalytic subunit 1
• Alternate names: queuine tRNA-ribosyltransferase catalytic subunit 1, TGT, 43-KD subunit, TGT, catalytic subunit, guanine insertion enzyme, queuine tRNA-ribosyltransferase 1, tRNA-guanine transglycosylase,
• Gene location: 19p13.2 (10701438: 10713364)     Exons: 10     NC_000019.10
• Gene summary(Entrez): This gene encodes the catalytic subunit of tRNA-guanine transglycosylase. tRNA-guanine transglycosylase is a heterodimeric enzyme complex that plays a critical role in tRNA modification by synthesizing the 7-deazaguanosine queuosine, which is found in tRN
• OMIM: 602388

Protein Summary

• Protein general information: Q9BXR0  
  • Name: Queuine tRNA ribosyltransferase catalytic subunit 1 (EC 2.4.2.29) (Guanine insertion enzyme) (tRNA guanine transglycosylase)
  • Length: 403  
  • Mass: 44048
• Sequence:

  MAGAATQASLESAPRIMRLVAECSRSRARAGELWLPHGTVATPVFMPVGTQATMKGITTEQLDALGCRICLGNTY
  HLGLRPGPELIQKANGLHGFMNWPHNLLTDSGGFQMVSLVSLSEVTEEGVRFRSPYDGNETLLSPEKSVQIQNAL
  GSDIIMQLDDVVSSTVTGPRVEEAMYRSIRWLDRCIAAHQRPDKQNLFAIIQGGLDADLRATCLEEMTKRDVPGF
  AIGGLSGGESKSQFWRMVALSTSRLPKDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTGNLQ
  LRKKVFEKDFGPIDPECTCPTCQKHSRAFLHALLHSDNTAALHHLTVHNIAYQLQLMSAVRTSIVEKRFPDFVRD
  FMGAMYGDPTLCPTWATDALASVGITLG

• Structural information:
  • Interpro: IPR004803  IPR036511  IPR002616  
  • PDB: 6H42 6H45
  • PDBsum: 6H42 6H45
  • STRING: ENSP00000250237
• Other Databases: GeneCards:  QTRT1  Malacards:  QTRT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006400	tRNA modification	IBA	biological process
GO:0008479	queuine tRNA-ribosyltransferase activity	IDA	molecular function
GO:0101030	tRNA-guanine transglycosylation	IDA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0046982	protein heterodimerization activity	IDA	molecular function
GO:0032991	protein-containing complex	IPI	cellular component
GO:0008479	queuine tRNA-ribosyltransferase activity	IEA	molecular function
GO:0101030	tRNA-guanine transglycosylation	IEA	biological process
GO:0006400	tRNA modification	IEA	biological process
GO:0016763	transferase activity, transferring pentosyl groups	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0008033	tRNA processing	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008479	queuine tRNA-ribosyltransferase activity	IEA	molecular function
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0006400	tRNA modification	TAS	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0101030	tRNA-guanine transglycosylation	IEA	biological process
GO:0032991	protein-containing complex	IEA	cellular component
GO:0008479	queuine tRNA-ribosyltransferase activity	IEA	molecular function
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0008479	queuine tRNA-ribosyltransferase activity	IEA	molecular function
GO:0101030	tRNA-guanine transglycosylation	IEA	biological process
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0101030	tRNA-guanine transglycosylation	NAS	biological process
GO:0008479	queuine tRNA-ribosyltransferase activity	TAS	molecular function
GO:0006400	tRNA modification	TAS	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq