• Gene id: 81873

Gene Summary

• Gene Symbol: ARPC5L   Gene   UCSC   Ensembl
• Aliases: ARC16-2
• Gene name: actin related protein 2/3 complex subunit 5 like
• Alternate names: actin-related protein 2/3 complex subunit 5-like protein, arp2/3 complex 16 kDa subunit 2, epididymis secretory sperm binding protein,
• Gene location: 9q33.3 (124862129: 124877732)     Exons: 7     NC_000009.12
• OMIM: 612565

Protein Summary

• Protein general information: Q9BPX5  
  • Name: Actin related protein 2/3 complex subunit 5 like protein (Arp2/3 complex 16 kDa subunit 2) (ARC16 2)
  • Length: 153  
  • Mass: 16941
• Sequence:

  MARNTLSSRFRRVDIDEFDENKFVDEQEEAAAAAAEPGPDPSEVDGLLRQGDMLRAFHAALRNSPVNTKNQAVKE
  RAQGVVLKVLTNFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTAR
  KTV

• Structural information:
  • Interpro: IPR006789  IPR036743  IPR030075  
  • DIP: 50399
  • STRING: ENSP00000345361
• Other Databases: GeneCards:  ARPC5L  Malacards:  ARPC5L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005885	Arp2/3 protein complex	IBA	cellular component
GO:0016477	cell migration	IBA	biological process
GO:0034314	Arp2/3 complex-mediated actin nucleation	IBA	biological process
GO:0051015	actin filament binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005885	Arp2/3 protein complex	IEA	cellular component
GO:0015629	actin cytoskeleton	IEA	cellular component
GO:0034314	Arp2/3 complex-mediated actin nucleation	IEA	biological process
GO:0030833	regulation of actin filament polymerization	IEA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0005925	focal adhesion	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa05131	Shigellosis
hsa04810	Regulation of actin cytoskeleton
hsa05132	Salmonella infection
hsa05130	Pathogenic Escherichia coli infection
hsa04666	Fc gamma R-mediated phagocytosis
hsa05100	Bacterial invasion of epithelial cells

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq