• Gene id: 81849

Gene Summary

• Gene Symbol: ST6GALNAC5   Gene   UCSC   Ensembl
• Aliases: SIAT7-E, SIAT7E, ST6GalNAcV
• Gene name: ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 5
• Alternate names: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5, GD1 alpha synthase, GalNAc alpha-2,6-sialyltransferase V, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5, ST6 GalNAc alpha-2,6-sialyltr,
• Gene location: 1p31.1 (76867448: 77069166)     Exons: 6     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a Golgi type II transmembrane glycosyltransferase. The encoded protein catalyzes the transfer of sialic acid to cell surface proteins to modulate cell-cell interactions. Several transcript variants encoding different is
• OMIM: 138253

Protein Summary

• Protein general information: Q9BVH7  
  • Name: Alpha N acetylgalactosaminide alpha 2,6 sialyltransferase 5 (EC 2.4.99. ) (GD1 alpha synthase) (GalNAc alpha 2,6 sialyltransferase V) (ST6GalNAc V) (ST6GalNAcV) (Sialyltransferase 7E) (SIAT7 E)
  • Length: 336  
  • Mass: 38443
• Sequence:

  MKTLMRHGLAVCLALTTMCTSLLLVYSSLGGQKERPPQQQQQQQQQQQQASATGSSQPAAESSTQQRPGVPAGPR
  PLDGYLGVADHKPLKMHCRDCALVTSSGHLLHSRQGSQIDQTECVIRMNDAPTRGYGRDVGNRTSLRVIAHSSIQ
  RILRNRHDLLNVSQGTVFIFWGPSSYMRRDGKGQVYNNLHLLSQVLPRLKAFMITRHKMLQFDELFKQETGKDRK
  ISNTWLSTGWFTMTIALELCDRINVYGMVPPDFCRDPNHPSVPYHYYEPFGPDECTMYLSHERGRKGSHHRFITE
  KRVFKNWARTFNIHFFQPDWKPESLAINHPENKPVF

• Structural information:
  • Interpro: IPR001675  IPR038578  IPR012163  
  • STRING: ENSP00000417583
• Other Databases: GeneCards:  ST6GALNAC5  Malacards:  ST6GALNAC5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001574	ganglioside biosynthetic process	IBA	biological process
GO:0097503	sialylation	IBA	biological process
GO:0009311	oligosaccharide metabolic process	IBA	biological process
GO:0008373	sialyltransferase activity	IBA	molecular function
GO:0001665	alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity	IBA	molecular function
GO:0006486	protein glycosylation	IEA	biological process
GO:0008373	sialyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0001665	alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity	ISS	molecular function
GO:0008373	sialyltransferase activity	ISS	molecular function
GO:0006688	glycosphingolipid biosynthetic process	ISS	biological process
GO:0009312	oligosaccharide biosynthetic process	ISS	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0006486	protein glycosylation	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00604	Glycosphingolipid biosynthesis - ganglio series

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881