• Gene id: 81847

Gene Summary

• Gene Symbol: RNF146   Gene   UCSC   Ensembl
• Gene name: ring finger protein 146
• Alternate names: E3 ubiquitin-protein ligase RNF146, RING-type E3 ubiquitin transferase RNF146, dactylidin, iduna,
• Gene location: 6q22.33 (127263414: 127289892)     Exons: 7     NC_000006.12
• OMIM: 118495

Protein Summary

• Protein general information: Q9NTX7  
  • Name: E3 ubiquitin protein ligase RNF146 (EC 2.3.2.27) (Dactylidin) (Iduna) (RING finger protein 146) (RING type E3 ubiquitin transferase RNF146)
  • Length: 359  
  • Mass: 38950
  • Tissue specificity: Ubiquitously expressed. Up-regulated in brains from patients with Alzheimer disease.
• Sequence:

  MMAGCGEIDHSINMLPTNRKANESCSNTAPSLTVPECAICLQTCVHPVSLPCKHVFCYLCVKGASWLGKRCALCR
  QEIPEDFLDKPTLLSPEELKAASRGNGEYAWYYEGRNGWWQYDERTSRELEDAFSKGKKNTEMLIAGFLYVADLE
  NMVQYRRNEHGRRRKIKRDIIDIPKKGVAGLRLDCDANTVNLARESSADGADSVSAQSGASVQPLVSSVRPLTSV
  DGQLTSPATPSPDASTSLEDSFAHLQLSGDNTAERSHRGEGEEDHESPSSGRVPAPDTSIEETESDASSDSEDVS
  AVVAQHSLTQQRLLVSNANQTVPDRSDRSGTDRSVAGGGTVSVSVRSRRPDGQCTVTEV

• Structural information:
  • Protein Domains: (92..16-)
    (/note="WWE-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00248"-)
  • Interpro: IPR033509  IPR004170  IPR018123  IPR037197  IPR001841   IPR013083  IPR017907  
  • Prosite: PS50918 PS00518 PS50089
  • PDB: 2D8T 3V3L 6CF6
  • PDBsum: 2D8T 3V3L 6CF6
  • DIP: 52730
  • STRING: ENSP00000357297
• Other Databases: GeneCards:  RNF146  Malacards:  RNF146

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004842	ubiquitin-protein transferase activity	IBA	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0072572	poly-ADP-D-ribose binding	IBA	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0072572	poly-ADP-D-ribose binding	IDA	molecular function
GO:0051865	protein autoubiquitination	IDA	biological process
GO:0070936	protein K48-linked ubiquitination	IMP	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0061630	ubiquitin protein ligase activity	IEA	molecular function
GO:0072572	poly-ADP-D-ribose binding	IEA	molecular function
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0090263	positive regulation of canonical Wnt signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0061630	ubiquitin protein ligase activity	TAS	molecular function
GO:0061630	ubiquitin protein ligase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881