• Gene id: 81844

Gene Summary

• Gene Symbol: TRIM56   Gene   UCSC   Ensembl
• Aliases: RNF109
• Gene name: tripartite motif containing 56
• Alternate names: E3 ubiquitin-protein ligase TRIM56, RING finger protein 109, RING-type E3 ubiquitin transferase TRIM56, tripartite motif-containing protein 56,
• Gene location: 7q22.1 (101085423: 101097966)     Exons: 3     NC_000007.14

Protein Summary

• Protein general information: Q9BRZ2  
  • Name: E3 ubiquitin protein ligase TRIM56 (EC 2.3.2.27) (RING finger protein 109) (RING type E3 ubiquitin transferase TRIM56) (Tripartite motif containing protein 56)
  • Length: 755  
  • Mass: 81488
  • Tissue specificity: Widely expressed (at protein level). {ECO
• Sequence:

  MVSHGSSPSLLEALSSDFLACKICLEQLRAPKTLPCLHTYCQDCLAQLADGGRVRCPECRETVPVPPEGVASFKT
  NFFVNGLLDLVKARACGDLRAGKPACALCPLVGGTSTGGPATARCLDCADDLCQACADGHRCTRQTHTHRVVDLV
  GYRAGWYDEEARERQAAQCPQHPGEALRFLCQPCSQLLCRECRLDPHLDHPCLPLAEAVRARRPGLEGLLAGVDN
  NLVELEAARRVEKEALARLREQAARVGTQVEEAAEGVLRALLAQKQEVLGQLRAHVEAAEEAARERLAELEGREQ
  VARAAAAFARRVLSLGREAEILSLEGAIAQRLRQLQGCPWAPGPAPCLLPQLELHPGLLDKNCHLLRLSFEEQQP
  QKDGGKDGAGTQGGEESQSRREDEPKTERQGGVQPQAGDGAQTPKEEKAQTTREEGAQTLEEDRAQTPHEDGGPQ
  PHRGGRPNKKKKFKGRLKSISREPSPALGPNLDGSGLLPRPIFYCSFPTRMPGDKRSPRITGLCPFGPREILVAD
  EQNRALKRFSLNGDYKGTVPVPEGCSPCSVAALQSAVAFSASARLYLINPNGEVQWRRALSLSQASHAVAALPSG
  DRVAVSVAGHVEVYNMEGSLATRFIPGGKASRGLRALVFLTTSPQGHFVGSDWQQNSVVICDGLGQVVGEYKGPG
  LHGCQPGSVSVDKKGYIFLTLREVNKVVILDPKGSLLGDFLTAYHGLEKPRVTTMVDGRYLVVSLSNGTIHIFRV
  RSPDS

• Structural information:
  • Interpro: IPR011042  IPR027370  IPR000315  IPR001841  IPR013083   IPR017907  
  • Prosite: PS50119 PS00518 PS50089
  • CDD: cd00021
  • PDB: 5JW7
  • PDBsum: 5JW7
  • STRING: ENSP00000305161
• Other Databases: GeneCards:  TRIM56  Malacards:  TRIM56

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004842	ubiquitin-protein transferase activity	IBA	molecular function
GO:0005654	nucleoplasm	IBA	cellular component
GO:0045087	innate immune response	IBA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IBA	biological process
GO:0000785	chromatin	IBA	cellular component
GO:0070534	protein K63-linked ubiquitination	ISS	biological process
GO:0051607	defense response to virus	ISS	biological process
GO:0034340	response to type I interferon	ISS	biological process
GO:0032608	interferon-beta production	ISS	biological process
GO:0004842	ubiquitin-protein transferase activity	ISS	molecular function
GO:0005737	cytoplasm	ISS	cellular component
GO:0008270	zinc ion binding	IEA	molecular function
GO:0051607	defense response to virus	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004842	ubiquitin-protein transferase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0032479	regulation of type I interferon production	TAS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq