• Gene id: 81832

Gene Summary

• Gene Symbol: NETO1   Gene   UCSC   Ensembl
• Aliases: BCTL1, BTCL1
• Gene name: neuropilin and tolloid like 1
• Alternate names: neuropilin and tolloid-like protein 1, brain-specific transmembrane protein containing 2 CUB and 1 LDL-receptor class A domains protein 1, neuropilin (NRP) and tolloid (TLL)-like 1,
• Gene location: 18q22.3 (72867986: 72742313)     Exons: 19     NC_000018.10
• Gene summary(Entrez): This gene encodes a transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. This protein is thought to play a critical role in spatial learning and memory by regulating the function of sy

Protein Summary

• Protein general information: Q8TDF5  
  • Name: Neuropilin and tolloid like protein 1 (Brain specific transmembrane protein containing 2 CUB and 1 LDL receptor class A domains protein 1)
  • Length: 533  
  • Mass: 60191
  • Tissue specificity: Isoform 1 and isoform 2 are retina-specific. Isoform 3 is found in retina as well as at lower levels in adult and fetal brain. {ECO
• Sequence:

  MIHGRSVLHIVASLIILHLSGATKKGTEKQTTSETQKSVQCGTWTKHAEGGIFTSPNYPSKYPPDRECIYIIEAA
  PRQCIELYFDEKYSIEPSWECKFDHIEVRDGPFGFSPIIGRFCGQQNPPVIKSSGRFLWIKFFADGELESMGFSA
  RYNFTPDPDFKDLGALKPLPACEFEMGGSEGIVESIQIMKEGKATASEAVDCKWYIRAPPRSKIYLRFLDYEMQN
  SNECKRNFVAVYDGSSSVEDLKAKFCSTVANDVMLRTGLGVIRMWADEGSRNSRFQMLFTSFQEPPCEGNTFFCH
  SNMCINNTLVCNGLQNCVYPWDENHCKEKRKTSLLDQLTNTSGTVIGVTSCIVIILIIISVIVQIKQPRKKYVQR
  KSDFDQTVFQEVFEPPHYELCTLRGTGATADFADVADDFENYHKLRRSSSKCIHDHHCGSQLSSTKGSRSNLSTR
  DASILTEMPTQPGKPLIPPMNRRNILVMKHSYSQDAADACDIDEIEEVPTTSHRLSRHDKAVQRFCLIGSLSKHE
  SEYNTTRV

• Structural information:
  • Protein Domains: (41..15-)
    (/note="CUB-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00059-)
    (172..28-)
    (/note="CUB-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00059-)
    (291..32-)
    A (/note="LDL-receptor-class)
    (/evidence="ECO:0000255|PROSITE-ProRule:-)
  • Interpro: IPR000859  IPR036055  IPR023415  IPR002172  IPR028867   IPR035914  
  • Prosite: PS01180 PS01209 PS50068
  • CDD: cd00041 cd00112
  • STRING: ENSP00000313088
• Other Databases: GeneCards:  NETO1  Malacards:  NETO1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007613	memory	ISS	biological process
GO:0060076	excitatory synapse	ISS	cellular component
GO:0048169	regulation of long-term neuronal synaptic plasticity	ISS	biological process
GO:0014069	postsynaptic density	ISS	cellular component
GO:0008542	visual learning	ISS	biological process
GO:0048168	regulation of neuronal synaptic plasticity	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:2000463	positive regulation of excitatory postsynaptic potential	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098839	postsynaptic density membrane	IEA	cellular component
GO:0097120	receptor localization to synapse	IEA	biological process
GO:0035255	ionotropic glutamate receptor binding	IEA	molecular function
GO:0007613	memory	IEA	biological process
GO:0099061	integral component of postsynaptic density membrane	IEA	cellular component
GO:0060076	excitatory synapse	IEA	cellular component
GO:0048169	regulation of long-term neuronal synaptic plasticity	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0008542	visual learning	IEA	biological process
GO:0098839	postsynaptic density membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0098839	postsynaptic density membrane	ISS	cellular component
GO:2000312	regulation of kainate selective glutamate receptor activity	IDA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq