• Gene id: 81831

Gene Summary

• Gene Symbol: NETO2   Gene   UCSC   Ensembl
• Aliases: BTCL2, NEOT2
• Gene name: neuropilin and tolloid like 2
• Alternate names: neuropilin and tolloid-like protein 2, brain-specific transmembrane protein containing 2 CUB and 1 LDL-receptor class A domains protein 2, neuropilin (NRP) and tolloid (TLL)-like 2,
• Gene location: 16q12.1 (47144024: 47077702)     Exons: 11     NC_000016.10
• Gene summary(Entrez): This gene encodes a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. A similar gene in rats encodes a protein that modulates glutamate signaling in the brain by regulatin
• OMIM: 614585

Protein Summary

• Protein general information: Q8NC67  
  • Name: Neuropilin and tolloid like protein 2 (Brain specific transmembrane protein containing 2 CUB and 1 LDL receptor class A domains protein 2)
  • Length: 525  
  • Mass: 59393
• Sequence:

  MALERLCSVLKVLLITVLVVEGIAVAQKTQDGQNIGIKHIPATQCGIWVRTSNGGHFASPNYPDSYPPNKECIYI
  LEAAPRQRIELTFDEHYYIEPSFECRFDHLEVRDGPFGFSPLIDRYCGVKSPPLIRSTGRFMWIKFSSDEELEGL
  GFRAKYSFIPDPDFTYLGGILNPIPDCQFELSGADGIVRSSQVEQEEKTKPGQAVDCIWTIKATPKAKIYLRFLD
  YQMEHSNECKRNFVAVYDGSSSIENLKAKFCSTVANDVMLKTGIGVIRMWADEGSRLSRFRMLFTSFVEPPCTSS
  TFFCHSNMCINNSLVCNGVQNCAYPWDENHCKEKKKAGVFEQITKTHGTIIGITSGIVLVLLIISILVQVKQPRK
  KVMACKTAFNKTGFQEVFDPPHYELFSLRDKEISADLADLSEELDNYQKMRRSSTASRCIHDHHCGSQASSVKQS
  RTNLSSMELPFRNDFAQPQPMKTFNSTFKKSSYTFKQGHECPEQALEDRVMEEIPCEIYVRGREDSAQASISIDF

• Structural information:
  • Protein Domains: (45..15-)
    (/note="CUB-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00059-)
    (177..29-)
    (/note="CUB-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00059-)
    (296..33-)
    A (/note="LDL-receptor-class)
    (/evidence="ECO:0000255|PROSITE-ProRule:-)
  • Interpro: IPR000859  IPR036055  IPR023415  IPR002172  IPR028868   IPR035914  
  • Prosite: PS01180 PS01209 PS50068
  • CDD: cd00041 cd00112
  • STRING: ENSP00000455169
• Other Databases: GeneCards:  NETO2  Malacards:  NETO2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2000312	regulation of kainate selective glutamate receptor activity	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0035255	ionotropic glutamate receptor binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:2000312	regulation of kainate selective glutamate receptor activity	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0035255	ionotropic glutamate receptor binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881