• Gene id: 818

Gene Summary

• Gene Symbol: CAMK2G   Gene   UCSC   Ensembl
• Aliases: CAMK, CAMK-II, CAMKG, MRD59
• Gene name: calcium/calmodulin dependent protein kinase II gamma
• Alternate names: calcium/calmodulin-dependent protein kinase type II subunit gamma, caMK-II subunit gamma, calcium/calmodulin-dependent protein kinase (CaM kinase) II gamma,
• Gene location: 10q22.2 (73874590: 73812500)     Exons: 25     NC_000010.11
• Gene summary(Entrez): The product of this gene is one of the four subunits of an enzyme which belongs to the serine/threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity
• OMIM: 607566

SNPs

rs6897876

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000005.10   g.142308074T>C
NC_000005.10   g.142308074T>G
NC_000005.9   g.141687639T>C
NC_000005.9   g.141687639T>G|SEQ=[T/C/G]

rs34605051

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000002.12   g.86466703T>C
NC_000002.11   g.86693826T>C
NG_047167.1   g.31057T>C
NM_018433.6   c.1339T>C
NM_018433.5   c.1339T>C
NM_001146688.1   c.1339T>C
XM_006712051.4   c.-637T>C
XM_024452995.1   c.1339T>C
XM_024452994.1   c.1339T>C
XM_017004494.1   c.484T>C
XM_02  

Protein Summary

• Protein general information: Q13555  
  • Name: Calcium/calmodulin dependent protein kinase type II subunit gamma (CaM kinase II subunit gamma) (CaMK II subunit gamma) (EC 2.7.11.17)
  • Length: 558  
  • Mass: 62607
  • Tissue specificity: Expressed in skeletal muscle. {ECO
• Sequence:

  MATTATCTRFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVR
  LHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQILESVNHIHQHDIVHRDLKPENLLLASKCKG
  AAVKLADFGLAIEVQGEQQAWFGFAGTPGYLSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQ
  IKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKL
  KGAILTTMLVSRNFSAAKSLLNKKSDGGVKKRKSSSSVHLMPQSNNKNSLVSPAQEPAPLQTAMEPQTTVVHNAT
  DGIKGSTESCNTTTEDEDLKGRVPEGRSSRDRTAPSAGMQPQPSLCSSAMRKQEIIKITEQLIEAINNGDFEAYT
  KICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPR
  TSQSEETRVWHRRDGKWLNVHYHCSGAPAAPLQ

• Structural information:
  • Protein Domains: (14..27-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR013543  IPR011009  IPR032710  IPR000719  IPR017441   IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 2UX0 2V7O
  • PDBsum: 2UX0 2V7O
  • DIP: 51315
  • STRING: ENSP00000319060
• Other Databases: GeneCards:  CAMK2G  Malacards:  CAMK2G

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0004683	calmodulin-dependent protein kinase activity	IBA	molecular function
GO:0005516	calmodulin binding	IBA	molecular function
GO:0043005	neuron projection	IBA	cellular component
GO:0051924	regulation of calcium ion transport	TAS	biological process
GO:0014733	regulation of skeletal muscle adaptation	TAS	biological process
GO:0010975	regulation of neuron projection development	IMP	biological process
GO:0004683	calmodulin-dependent protein kinase activity	IEA	molecular function
GO:0005516	calmodulin binding	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0005516	calmodulin binding	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0016529	sarcoplasmic reticulum	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0004683	calmodulin-dependent protein kinase activity	IEA	molecular function
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:1900034	regulation of cellular response to heat	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0005954	calcium- and calmodulin-dependent protein kinase complex	IDA	cellular component
GO:0033017	sarcoplasmic reticulum membrane	IEA	cellular component
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0004723	calcium-dependent protein serine/threonine phosphatase activity	NAS	molecular function
GO:0030073	insulin secretion	NAS	biological process
GO:0005516	calmodulin binding	NAS	molecular function
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05012	Parkinson disease
hsa04024	cAMP signaling pathway
hsa04020	Calcium signaling pathway
hsa04360	Axon guidance
hsa05205	Proteoglycans in cancer
hsa04310	Wnt signaling pathway
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04934	Cushing syndrome
hsa05152	Tuberculosis
hsa04217	Necroptosis
hsa04740	Olfactory transduction
hsa04921	Oxytocin signaling pathway
hsa04728	Dopaminergic synapse
hsa04114	Oocyte meiosis
hsa04722	Neurotrophin signaling pathway
hsa04725	Cholinergic synapse
hsa04922	Glucagon signaling pathway
hsa04916	Melanogenesis
hsa04713	Circadian entrainment
hsa04925	Aldosterone synthesis and secretion
hsa04750	Inflammatory mediator regulation of TRP channels
hsa04066	HIF-1 signaling pathway
hsa04912	GnRH signaling pathway
hsa04911	Insulin secretion
hsa04012	ErbB signaling pathway
hsa04971	Gastric acid secretion
hsa04720	Long-term potentiation
hsa05031	Amphetamine addiction
hsa05214	Glioma

Diseases

Associated diseases	References
Astrocytoma	PMID:12937144
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq