• Gene id: 81793

Gene Summary

• Gene Symbol: TLR10   Gene   UCSC   Ensembl
• Aliases: CD290
• Gene name: toll like receptor 10
• Alternate names: toll-like receptor 10,
• Gene location: 4p14 (38782989: 38772237)     Exons: 5     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and func
• OMIM: 606270

Protein Summary

• Protein general information: Q9BXR5  
  • Name: Toll like receptor 10 (EC 3.2.2.6) (CD antigen CD290)
  • Length: 811  
  • Mass: 94564
  • Tissue specificity: Highly expressed in spleen, lymph node, thymus, tonsil and at lower levels in lung. Highly expressed in promyelocytic HL-60 cells and in B-cell lines.
• Sequence:

  MRLIRNIYIFCSIVMTAEGDAPELPEERELMTNCSNMSLRKVPADLTPATTTLDLSYNLLFQLQSSDFHSVSKLR
  VLILCHNRIQQLDLKTFEFNKELRYLDLSNNRLKSVTWYLLAGLRYLDLSFNDFDTMPICEEAGNMSHLEILGLS
  GAKIQKSDFQKIAHLHLNTVFLGFRTLPHYEEGSLPILNTTKLHIVLPMDTNFWVLLRDGIKTSKILEMTNIDGK
  SQFVSYEMQRNLSLENAKTSVLLLNKVDLLWDDLFLILQFVWHTSVEHFQIRNVTFGGKAYLDHNSFDYSNTVMR
  TIKLEHVHFRVFYIQQDKIYLLLTKMDIENLTISNAQMPHMLFPNYPTKFQYLNFANNILTDELFKRTIQLPHLK
  TLILNGNKLETLSLVSCFANNTPLEHLDLSQNLLQHKNDENCSWPETVVNMNLSYNKLSDSVFRCLPKSIQILDL
  NNNQIQTVPKETIHLMALRELNIAFNFLTDLPGCSHFSRLSVLNIEMNFILSPSLDFVQSCQEVKTLNAGRNPFR
  CTCELKNFIQLETYSEVMMVGWSDSYTCEYPLNLRGTRLKDVHLHELSCNTALLIVTIVVIMLVLGLAVAFCCLH
  FDLPWYLRMLGQCTQTWHRVRKTTQEQLKRNVRFHAFISYSEHDSLWVKNELIPNLEKEDGSILICLYESYFDPG
  KSISENIVSFIEKSYKSIFVLSPNFVQNEWCHYEFYFAHHNLFHENSDHIILILLEPIPFYCIPTRYHKLKALLE
  KKAYLEWPKDRRKCGLFWANLRAAINVNVLATREMYELQTFTELNEESRGSTISLMRTDCL

• Structural information:
  • Protein Domains: (522..57-)
    (/note="LRRCT-)
    (632..77-)
    (/note="TIR-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00204"-)
  • Interpro: IPR000483  IPR001611  IPR003591  IPR032675  IPR000157   IPR027182  IPR035897  
  • Prosite: PS51450 PS50104
  • PDB: 2J67
  • PDBsum: 2J67
  • STRING: ENSP00000308925
• Other Databases: GeneCards:  TLR10  Malacards:  TLR10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0038023	signaling receptor activity	IBA	molecular function
GO:0006954	inflammatory response	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0002224	toll-like receptor signaling pathway	IBA	biological process
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0034166	toll-like receptor 10 signaling pathway	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0050707	regulation of cytokine secretion	IEA	biological process
GO:0050729	positive regulation of inflammatory response	IEA	biological process
GO:0002224	toll-like receptor signaling pathway	IEA	biological process
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0006955	immune response	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0050135	NAD(P)+ nucleosidase activity	IEA	molecular function
GO:0061809	NAD+ nucleotidase, cyclic ADP-ribose generating	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0034166	toll-like receptor 10 signaling pathway	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0004888	transmembrane signaling receptor activity	TAS	molecular function
GO:0016020	membrane	TAS	cellular component
GO:0006955	immune response	NAS	biological process

Diseases

Associated diseases	References
Asthma	PMID:18547625
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)