• Gene id: 81706

Gene Summary

• Gene Symbol: PPP1R14C   Gene   UCSC   Ensembl
• Aliases: CPI17-like, KEPI, NY-BR-81
• Gene name: protein phosphatase 1 regulatory inhibitor subunit 14C
• Alternate names: protein phosphatase 1 regulatory subunit 14C, PKC-potentiated PP1 inhibitory protein, kinase C-enhanced PP1 inhibitor, kinase-enhanced PP1 inhibitor, serologically defined breast cancer antigen NY-BR-81,
• Gene location: 6q25.1 (150143043: 150250391)     Exons: 5     NC_000006.12
• Gene summary(Entrez): The degree of protein phosphorylation is regulated by a balance of protein kinase and phosphatase activities. Protein phosphatase-1 (PP1; see MIM 176875) is a signal-transducing phosphatase that influences neuronal activity, protein synthesis, metabolism,
• OMIM: 613242

Protein Summary

• Protein general information: Q8TAE6  
  • Name: Protein phosphatase 1 regulatory subunit 14C (Kinase enhanced PP1 inhibitor) (PKC potentiated PP1 inhibitory protein) (Serologically defined breast cancer antigen NY BR 81)
  • Length: 165  
  • Mass: 17843
  • Tissue specificity: Detected in breast cancer. {ECO
• Sequence:

  MSVATGSSETAGGASGGGARVFFQSPRGGAGGSPGSSSGSGSSREDSAPVATAAAAGQVQQQQQRRHQQGKVTVK
  YDRKELRKRLVLEEWIVEQLGQLYGCEEEEMPEVEIDIDDLLDADSDEERASKLQEALVDCYKPTEEFIKELLSR
  IRGMRKLSPPQKKSV

• Structural information:
  • Interpro: IPR008025  IPR036658  
  • STRING: ENSP00000355260
• Other Databases: GeneCards:  PPP1R14C  Malacards:  PPP1R14C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004865	protein serine/threonine phosphatase inhibitor activity	IBA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0042325	regulation of phosphorylation	IEA	biological process
GO:0004864	protein phosphatase inhibitor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004865	protein serine/threonine phosphatase inhibitor activity	IEA	molecular function
GO:0004865	protein serine/threonine phosphatase inhibitor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0032515	negative regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0032515	negative regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0032515	negative regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0032515	negative regulation of phosphoprotein phosphatase activity	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq