Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 81631
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol MAP1LC3B   Gene   UCSC   Ensembl
Aliases ATG8F, LC3B, MAP1A/1BLC3, MAP1LC3B-a
Gene name microtubule associated protein 1 light chain 3 beta
Alternate names microtubule-associated proteins 1A/1B light chain 3B, MAP1 light chain 3-like protein 2, MAP1A/MAP1B LC3 B, MAP1A/MAP1B light chain 3 B, autophagy-related ubiquitin-like modifier LC3 B,
Gene location 16q24.2 (87392335: 87404773)     Exons: 4     NC_000016.10
Gene summary(Entrez) The product of this gene is a subunit of neuronal microtubule-associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. Studies on the rat homolog implicate a role for this gene in autophagy, a proces
OMIM 609604

Protein Summary
Protein general information Q9GZQ8  

Name: Microtubule associated proteins 1A/1B light chain 3B (Autophagy related protein LC3 B) (Autophagy related ubiquitin like modifier LC3 B) (MAP1 light chain 3 like protein 2) (MAP1A/MAP1B light chain 3 B) (MAP1A/MAP1B LC3 B) (Microtubule associated protein

Length: 125  Mass: 14688

Tissue specificity: Most abundant in heart, brain, skeletal muscle and testis. Little expression observed in liver. {ECO

Sequence MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNA
NQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV
Structural information
Interpro:  IPR004241  IPR029071  

PDB:  		 1V49 2LUE 2N9X 2ZJD 3VTU 3VTV 3VTW 3WAO 3X0W 4WAA 5D94 5DCN 5GMV 5MS2 5MS5 5MS6 5V4K 5W9A 5XAC 5XAD 5XAE 6J04
PDBsum:   1V49 2LUE 2N9X 2ZJD 3VTU 3VTV 3VTW 3WAO 3X0W 4WAA 5D94 5DCN 5GMV 5MS2 5MS5 5MS6 5V4K 5W9A 5XAC 5XAD 5XAE 6J04

DIP:  
29760
MINT:  
STRING:   ENSP00000268607
Other Databases GeneCards:  MAP1LC3B  Malacards:  MAP1LC3B

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0005515 protein binding
 IPI molecular function
GO:0005739 mitochondrion
 IDA cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0000422 autophagy of mitochondrio
n
 IGI biological process
GO:0005829 cytosol
 IBA cellular component
GO:0006995 cellular response to nitr
ogen starvation
 IBA biological process
GO:0008017 microtubule binding
 IBA molecular function
GO:0031625 ubiquitin protein ligase
binding
 IBA molecular function
GO:0000045 autophagosome assembly
 IBA biological process
GO:0000421 autophagosome membrane
 IBA cellular component
GO:0000422 autophagy of mitochondrio
n
 IBA biological process
GO:0005776 autophagosome
 IBA cellular component
GO:0016236 macroautophagy
 IBA biological process
GO:0097352 autophagosome maturation
 IBA biological process
GO:0000423 mitophagy
 IDA biological process
GO:0005776 autophagosome
 IDA cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005930 axoneme
 ISS cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0031410 cytoplasmic vesicle
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0006914 autophagy
 IEA biological process
GO:0016020 membrane
 IEA cellular component
GO:0005874 microtubule
 IEA cellular component
GO:0005856 cytoskeleton
 IEA cellular component
GO:0005739 mitochondrion
 IDA cellular component
GO:0000421 autophagosome membrane
 TAS cellular component
GO:0000421 autophagosome membrane
 TAS cellular component
GO:0016236 macroautophagy
 TAS biological process
GO:0016236 macroautophagy
 TAS biological process
GO:0016236 macroautophagy
 TAS biological process
GO:0097352 autophagosome maturation
 TAS biological process
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005622 intracellular
 IDA cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0012505 endomembrane system
 IEA cellular component
GO:0005856 cytoskeleton
 IEA cellular component
GO:0000421 autophagosome membrane
 IEA cellular component
GO:0005776 autophagosome
 IEA cellular component
GO:0043231 intracellular membrane-bo
unded organelle
 IDA cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0006914 autophagy
 IDA biological process
GO:0097352 autophagosome maturation
 IDA biological process
GO:0009267 cellular response to star
vation
 IDA biological process
GO:0005776 autophagosome
 IDA cellular component
GO:0016236 macroautophagy
 IDA biological process
GO:0031090 organelle membrane
 ISS cellular component
GO:0005776 autophagosome
 ISS cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0031625 ubiquitin protein ligase
binding
 IPI molecular function

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04216Ferroptosis

Diseases

Expand All | Collapse All
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia
19 (6 controls
, 13 cases)
 Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract