• Gene id: 81627

Gene Summary

• Gene Symbol: TRMT1L   Gene   UCSC   Ensembl
• Aliases: C1orf25, MST070, MSTP070, TRM1L, bG120K12.3
• Gene name: tRNA methyltransferase 1 like
• Alternate names: TRMT1-like protein, TRM1 tRNA methyltransferase 1-like, TRM1-like protein, tRNA methyltransferase 1 homolog-like,
• Gene location: 1q25.3 (185157097: 185118084)     Exons: 17     NC_000001.11
• Gene summary(Entrez): This gene encodes a protein that has some similarity to N2,N2-dimethylguanosine tRNA methyltransferase from other organisms. Studies of the mouse ortholog have shown that this protein plays a role in motor coordination and exploratory behavior, and it may
• OMIM: 611673

Protein Summary

• Protein general information: Q7Z2T5  
  • Name: TRMT1 like protein (EC 2.1.1. )
  • Length: 733  
  • Mass: 81747
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MENMAEEELLPLEKEEVEVAQVQVPTPARDSAGVPAPAPDSALDSAPTPASAPAPAPALAQAPALSPSLASAPEE
  AKSKRHISIQRQLADLENLAFVTDGNFDSASSLNSDNLDAGNRQACPLCPKEKFRACNSHKLRRHLQNLHWKVSV
  EFEGYRMCICHLPCRPVKPNIIGEQITSKMGAHYHCIICSATITRRTDMLGHVRRHMNKGETKSSYIAASTAKPP
  KEILKEADTDVQVCPNYSIPQKTDSYFNPKMKLNRQLIFCTLAALAEERKPLECLDAFGATGIMGLQWAKHLGNA
  VKVTINDLNENSVTLIQENCHLNKLKVVVDSKEKEKSDDILEEGEKNLGNIKVTKMDANVLMHLRSFDFIHLDPF
  GTSVNYLDSAFRNIRNLGIVSVTSTDISSLYAKAQHVARRHYGCNIVRTEYYKELAARIVVAAVARAAARCNKGI
  EVLFAVALEHFVLVVVRVLRGPTSADETAKKIQYLIHCQWCEERIFQKDGNMVEENPYRQLPCNCHGSMPGKTAI
  ELGPLWSSSLFNTGFLKRMLFESLHHGLDDIQTLIKTLIFESECTPQSQFSIHASSNVNKQEENGVFIKTTDDTT
  TDNYIAQGKRKSNEMITNLGKKQKTDVSTEHPPFYYNIHRHSIKGMNMPKLKKFLCYLSQAGFRVSRTHFDPMGV
  RTDAPLMQFKSILLKYSTPTYTGGQSESHVQSASEDTVTERVEMSVNDKAEASGCRRW

• Structural information:
  • Protein Domains: (227..68-)
    (/note="Trm1-methyltransferase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00958"-)
  • Interpro: IPR029063  IPR002905  IPR042296  IPR013087  
  • Prosite: PS51626 PS00028 PS50157
  • STRING: ENSP00000356476
• Other Databases: GeneCards:  TRMT1L  Malacards:  TRMT1L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004809	tRNA (guanine-N2-)-methyltransferase activity	IBA	molecular function
GO:0002940	tRNA N2-guanine methylation	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0004809	tRNA (guanine-N2-)-methyltransferase activity	IEA	molecular function
GO:0008033	tRNA processing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0000049	tRNA binding	IEA	molecular function
GO:0032259	methylation	IEA	biological process
GO:0008033	tRNA processing	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0007610	behavior	IEA	biological process
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray