• Gene id: 81619

Gene Summary

• Gene Symbol: TSPAN14   Gene   UCSC   Ensembl
• Aliases: DC-TM4F2, TM4SF14, tspan-14
• Gene name: tetraspanin 14
• Alternate names: tetraspanin-14, tetraspanin similar to TM4SF9, transmembrane 4 superfamily member 14,
• Gene location: 10q23.1 (80454264: 80533123)     Exons: 15     NC_000010.11
• OMIM: 611591

Protein Summary

• Protein general information: Q8NG11  
  • Name: Tetraspanin 14 (Tspan 14) (DC TM4F2) (Transmembrane 4 superfamily member 14)
  • Length: 270  
  • Mass: 30691
• Sequence:

  MHYYRYSNAKVSCWYKYLLFSYNIIFWLAGVVFLGVGLWAWSEKGVLSDLTKVTRMHGIDPVVLVLMVGVVMFTL
  GFAGCVGALRENICLLNFFCGTIVLIFFLELAVAVLAFLFQDWVRDRFREFFESNIKSYRDDIDLQNLIDSLQKA
  NQCCGAYGPEDWDLNVYFNCSGASYSREKCGVPFSCCVPDPAQKVVNTQCGYDVRIQLKSKWDESIFTKGCIQAL
  ESWLPRNIYIVAGVFIAISLLQIFGIFLARTLISDIEAVKAGHHF

• Structural information:
  • Interpro: IPR000301  IPR018499  IPR018503  IPR008952  
  • Prosite: PS00421
  • STRING: ENSP00000396270
• Other Databases: GeneCards:  TSPAN14  Malacards:  TSPAN14

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0070821	tertiary granule membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051604	protein maturation	IEA	biological process
GO:0097197	tetraspanin-enriched microdomain	IEA	cellular component
GO:0019899	enzyme binding	IEA	molecular function
GO:0009986	cell surface	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0019899	enzyme binding	IPI	molecular function
GO:0051604	protein maturation	IMP	biological process
GO:0072659	protein localization to plasma membrane	IMP	biological process
GO:0072659	protein localization to plasma membrane	IMP	biological process
GO:0045747	positive regulation of Notch signaling pathway	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq