• Gene id: 81615

Gene Summary

• Gene Symbol: TMEM163   Gene   UCSC   Ensembl
• Aliases: DC29, SV31
• Gene name: transmembrane protein 163
• Alternate names: transmembrane protein 163,
• Gene location: 2q21.3 (134720933: 134455758)     Exons: 12     NC_000002.12
• OMIM: 601637

Protein Summary

• Protein general information: Q8TC26  
  • Name: Transmembrane protein 163
  • Length: 289  
  • Mass: 31469
• Sequence:

  MEPAAGIQRRSSQGPTVPPPPRGHAPPAAAPGPAPLSSPVREPPQLEEERQVRISESGQFSDGLEDRGLLESSTR
  LKPHEAQNYRKKALWVSWFSIIVTLALAVAAFTVSVMRYSASAFGFAFDAILDVLSSAIVLWRYSNAAAVHSAHR
  EYIACVILGVIFLLSSICIVVKAIHDLSTRLLPEVDDFLFSVSILSGILCSILAVLKFMLGKVLTSRALITDGFN
  SLVGGVMGFSILLSAEVFKHDSAVWYLDGSIGVLIGLTIFAYGVKLLIDMVPRVRQTRHYEMFE

• Structural information:
  • Interpro: IPR027469  IPR026765  
  • STRING: ENSP00000281924
• Other Databases: GeneCards:  TMEM163  Malacards:  TMEM163

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031901	early endosome membrane	ISS	cellular component
GO:0030285	integral component of synaptic vesicle membrane	ISS	cellular component
GO:0008270	zinc ion binding	ISS	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008270	zinc ion binding	IEA	molecular function
GO:0030285	integral component of synaptic vesicle membrane	IEA	cellular component
GO:0031901	early endosome membrane	IEA	cellular component
GO:0099180	zinc ion import into synaptic vesicle	IEA	biological process
GO:0030285	integral component of synaptic vesicle membrane	IEA	cellular component
GO:0031901	early endosome membrane	IEA	cellular component
GO:0030672	synaptic vesicle membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq