• Gene id: 81611

Gene Summary

• Gene Symbol: ANP32E   Gene   UCSC   Ensembl
• Aliases: LANP-L, LANPL
• Gene name: acidic nuclear phosphoprotein 32 family member E
• Alternate names: acidic leucine-rich nuclear phosphoprotein 32 family member E, LANP-like protein, acidic (leucine-rich) nuclear phosphoprotein 32 family, member E, leucine-rich acidic nuclear protein like,
• Gene location: 1q21.2 (150236132: 150218416)     Exons: 8     NC_000001.11
• OMIM: 609611

Protein Summary

• Protein general information: Q9BTT0  
  • Name: Acidic leucine rich nuclear phosphoprotein 32 family member E (LANP like protein) (LANP L)
  • Length: 268  
  • Mass: 30692
  • Tissue specificity: Expressed in peripheral blood leukocytes, colon, small intestine, prostate, thymus, spleen, skeletal muscle, liver and kidney. {ECO
• Sequence:

  MEMKKKINLELRNRSPEEVTELVLDNCLCVNGEIEGLNDTFKELEFLSMANVELSSLARLPSLNKLRKLELSDNI
  ISGGLEVLAEKCPNLTYLNLSGNKIKDLSTVEALQNLKNLKSLDLFNCEITNLEDYRESIFELLQQITYLDGFDQ
  EDNEAPDSEEEDDEDGDEDDEEEEENEAGPPEGYEEEEEEEEEEDEDEDEDEDEAGSELGEGEEEVGLSYLMKEE
  IQDEEDDDDYVEEGEEEEEEEEGGLRGEKRKRDAEDDGEEEDD

• Structural information:
  • Protein Domains: (123..16-)
    (/note="LRRCT"-)
  • Interpro: IPR001611  IPR032675  
  • Prosite: PS51450
  • PDB: 4CAY 4NFT
  • PDBsum: 4CAY 4NFT
  • STRING: ENSP00000463154
• Other Databases: GeneCards:  ANP32E  Malacards:  ANP32E

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019212	phosphatase inhibitor activity	IBA	molecular function
GO:0042981	regulation of apoptotic process	IBA	biological process
GO:0043486	histone exchange	IBA	biological process
GO:0042393	histone binding	IBA	molecular function
GO:0042393	histone binding	IDA	molecular function
GO:0043486	histone exchange	IDA	biological process
GO:0000812	Swr1 complex	IDA	cellular component
GO:0006325	chromatin organization	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0019212	phosphatase inhibitor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043086	negative regulation of catalytic activity	IEA	biological process
GO:0043086	negative regulation of catalytic activity	IEA	biological process
GO:0043086	negative regulation of catalytic activity	IEA	biological process
GO:0031410	cytoplasmic vesicle	ISS	cellular component
GO:0019212	phosphatase inhibitor activity	ISS	molecular function
GO:0005634	nucleus	ISS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881