• Gene id: 81607

Gene Summary

• Gene Symbol: NECTIN4   Gene   UCSC   Ensembl
• Aliases: EDSS1, LNIR, PRR4, PVRL4, nectin-4
• Gene name: nectin cell adhesion molecule 4
• Alternate names: nectin-4, Ig superfamily receptor LNIR, nectin 4, poliovirus receptor-related 4, poliovirus receptor-related protein 4,
• Gene location: 1q23.3 (161089565: 161070997)     Exons: 9     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the nectin family. The encoded protein contains two immunoglobulin-like (Ig-like) C2-type domains and one Ig-like V-type domain. It is involved in cell adhesion through trans-homophilic and -heterophilic interactions. It is a
• OMIM: 609607

Protein Summary

• Protein general information: Q96NY8  
  • Name: Nectin 4 (Ig superfamily receptor LNIR) (Nectin cell adhesion molecule 4) (Poliovirus receptor related protein 4) [Cleaved into: Processed poliovirus receptor related protein 4]
  • Length: 510  
  • Mass: 55454
  • Tissue specificity: Predominantly expressed in placenta. Not detected in normal breast epithelium but expressed in breast carcinoma. {ECO
• Sequence:

  MPLSLGAEMWGPEAWLLLLLLLASFTGRCPAGELETSDVVTVVLGQDAKLPCFYRGDSGEQVGQVAWARVDAGEG
  AQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLRVLVPPL
  PSLNPGPALEEGQGLTLAASCTAEGSPAPSVTWDTEVKGTTSSRSFKHSRSAAVTSEFHLVPSRSMNGQPLTCVV
  SHPGLLQDQRITHILHVSFLAEASVRGLEDQNLWHIGREGAMLKCLSEGQPPPSYNWTRLDGPLPSGVRVDGDTL
  GFPPLTTEHSGIYVCHVSNEFSSRDSQVTVDVLDPQEDSGKQVDLVSASVVVVGVIAALLFCLLVVVVVLMSRYH
  RRKAQQMTQKYEEELTLTRENSIRRLHSHHTDPRSQPEESVGLRAEGHPDSLKDNSSCSVMSEEPEGRSYSTLTT
  VREIETQTELLSPGSGRAEEEEDQDEGIKQAMNHFVQENGTLRAKPTGNGIYINGRGHLV

• Structural information:
  • Protein Domains: (32..14-)
    (/note="Ig-like-V-type)
    (148..23-)
    1 (/note="Ig-like-C2-type)
    (248..33-)
    2" (/note="Ig-like-C2-type)
  • Interpro: IPR013162  IPR007110  IPR036179  IPR013783  IPR003599   IPR003598  IPR013106  IPR033320  
  • Prosite: PS50835
  • PDB: 4FRW 4GJT 4JJH
  • PDBsum: 4FRW 4GJT 4JJH
  • DIP: 41492
  • STRING: ENSP00000356991
• Other Databases: GeneCards:  NECTIN4  Malacards:  NECTIN4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	IBA	biological process
GO:0005912	adherens junction	IBA	cellular component
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IBA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0046718	viral entry into host cell	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0001618	virus receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0034332	adherens junction organization	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005912	adherens junction	IDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005912	adherens junction	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04520	Adherens junction

Diseases

Associated diseases	References
Ectodermal dysplasia-syndactyly syndrome	KEGG:H00647
Ectodermal dysplasia-syndactyly syndrome	KEGG:H00647
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq