• Gene id: 81602

Gene Summary

• Gene Symbol: CDADC1   Gene   UCSC   Ensembl
• Aliases: NYD-SP15, bA103J18.1
• Gene name: cytidine and dCMP deaminase domain containing 1
• Alternate names: cytidine and dCMP deaminase domain-containing protein 1, protein kinase NYD-SP15, testis development protein NYD-SP15,
• Gene location: 13q14.2 (49247874: 49293485)     Exons: 15     NC_000013.11

Protein Summary

• Protein general information: Q9BWV3  
  • Name: Cytidine and dCMP deaminase domain containing protein 1 (Testis development protein NYD SP15)
  • Length: 514  
  • Mass: 58455
  • Tissue specificity: Widely expressed. Expressed at high levels in the testis. {ECO
• Sequence:

  MKEAGQMQNLESARAGRSVSTQTGSMTGQIPRLSKVNLFTLLSLWMELFPAEAQRQKSQKNEEGKHGPLGDNEER
  TRVSTDKRQVKRTGLVVVKNMKIVGLHCSSEDLHAGQIALIKHGSRLKNCDLYFSRKPCSACLKMIVNAGVNRIS
  YWPADPEISLLTEASSSEDAKLDAKAVERLKSNSRAHVCVLLQPLVCYMVQFVEETSYKCDFIQKITKTLPDANT
  DFYYECKQERIKEYEMLFLVSNEEMHKQILMTIGLENLCENPYFSNLRQNMKDLILLLATVASSVPNFKHFGFYR
  SNPEQINEIHNQSLPQEIARHCMVQARLLAYRTEDHKTGVGAVIWAEGKSRSCDGTGAMYFVGCGYNAFPVGSEY
  ADFPHMDDKQKDREIRKFRYIIHAEQNALTFRCQEIKPEERSMIFVTKCPCDECVPLIKGAGIKQIYAGDVDVGK
  KKADISYMRFGELEGVSKFTWQLNPSGAYGLEQNEPERRENGVLRPVPQKEEQHQDKKLRLGIH

• Structural information:
  • Protein Domains: (70..16-)
    1 (/note="CMP/dCMP-type-deaminase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01083-)
    (317..48-)
    2 (/note="CMP/dCMP-type-deaminase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01083"-)
  • Interpro: IPR016192  IPR002125  IPR016193  IPR015517  IPR035105  
  • Prosite: PS00903 PS51747
  • CDD: cd01286
  • STRING: ENSP00000251108
• Other Databases: GeneCards:  CDADC1  Malacards:  CDADC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004132	dCMP deaminase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0006226	dUMP biosynthetic process	IBA	biological process
GO:0006231	dTMP biosynthetic process	IBA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0070383	DNA cytosine deamination	IDA	biological process
GO:0004126	cytidine deaminase activity	IDA	molecular function
GO:0061676	importin-alpha family protein binding	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0009972	cytidine deamination	IDA	biological process
GO:0005634	nucleus	IMP	cellular component
GO:0008270	zinc ion binding	IMP	molecular function
GO:0005737	cytoplasm	IMP	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq