• Gene id: 81579

Gene Summary

• Gene Symbol: PLA2G12A   Gene   UCSC   Ensembl
• Aliases: GXII, PLA2G12, ROSSY
• Gene name: phospholipase A2 group XIIA
• Alternate names: group XIIA secretory phospholipase A2, GXII sPLA2, group XII secreted phospholipase A2, group XIIA secreted phospholipase A2, phosphatidylcholine 2-acylhydrolase 12A, phospholipase A2, group XII, sPLA2-XII,
• Gene location: 4q25 (109730069: 109709988)     Exons: 4     NC_000004.12
• Gene summary(Entrez): Secreted phospholipase A2 (sPLA2) enzymes liberate arachidonic acid from phospholipids for production of eicosanoids and exert a variety of physiologic and pathologic effects. Group XII sPLA2s, such as PLA2G12A, have relatively low specific activity and a

Protein Summary

• Protein general information: Q9BZM1  
  • Name: Group XIIA secretory phospholipase A2 (GXII sPLA2) (sPLA2 XII) (EC 3.1.1.4) (Phosphatidylcholine 2 acylhydrolase 12A)
  • Length: 189  
  • Mass: 21067
  • Tissue specificity: Abundantly expressed in heart, skeletal muscle, kidney, liver and pancreas.
• Sequence:

  MALLSRPALTLLLLLMAAVVRCQEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFP
  RYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQ
  ACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTDL

• Structural information:
  • Interpro: IPR010711  IPR036444  IPR033113  
  • Prosite: PS00118
  • STRING: ENSP00000243501
• Other Databases: GeneCards:  PLA2G12A  Malacards:  PLA2G12A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004623	phospholipase A2 activity	IBA	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0006644	phospholipid metabolic process	IEA	biological process
GO:0004623	phospholipase A2 activity	IEA	molecular function
GO:0016042	lipid catabolic process	IEA	biological process
GO:0050482	arachidonic acid secretion	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016042	lipid catabolic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0102567	phospholipase A2 activity (consuming 1,2-dipalmitoylphosphatidylcholine)	IEA	molecular function
GO:0004623	phospholipase A2 activity	IEA	molecular function
GO:0102568	phospholipase A2 activity consuming 1,2-dioleoylphosphatidylethanolamine)	IEA	molecular function
GO:0036148	phosphatidylglycerol acyl-chain remodeling	TAS	biological process
GO:0036149	phosphatidylinositol acyl-chain remodeling	TAS	biological process
GO:0036150	phosphatidylserine acyl-chain remodeling	TAS	biological process
GO:0036152	phosphatidylethanolamine acyl-chain remodeling	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0006654	phosphatidic acid biosynthetic process	TAS	biological process
GO:0036151	phosphatidylcholine acyl-chain remodeling	TAS	biological process
GO:0004623	phospholipase A2 activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0047498	calcium-dependent phospholipase A2 activity	NAS	molecular function
GO:0008150	biological_process	ND	biological process
GO:0005576	extracellular region	NAS	cellular component
GO:0004623	phospholipase A2 activity	IBA	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0006644	phospholipid metabolic process	IEA	biological process
GO:0004623	phospholipase A2 activity	IEA	molecular function
GO:0016042	lipid catabolic process	IEA	biological process
GO:0050482	arachidonic acid secretion	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016042	lipid catabolic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0102567	phospholipase A2 activity (consuming 1,2-dipalmitoylphosphatidylcholine)	IEA	molecular function
GO:0004623	phospholipase A2 activity	IEA	molecular function
GO:0102568	phospholipase A2 activity consuming 1,2-dioleoylphosphatidylethanolamine)	IEA	molecular function
GO:0036148	phosphatidylglycerol acyl-chain remodeling	TAS	biological process
GO:0036149	phosphatidylinositol acyl-chain remodeling	TAS	biological process
GO:0036150	phosphatidylserine acyl-chain remodeling	TAS	biological process
GO:0036152	phosphatidylethanolamine acyl-chain remodeling	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0006654	phosphatidic acid biosynthetic process	TAS	biological process
GO:0036151	phosphatidylcholine acyl-chain remodeling	TAS	biological process
GO:0004623	phospholipase A2 activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0047498	calcium-dependent phospholipase A2 activity	NAS	molecular function
GO:0008150	biological_process	ND	biological process
GO:0005576	extracellular region	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04014	Ras signaling pathway
hsa04270	Vascular smooth muscle contraction
hsa00564	Glycerophospholipid metabolism
hsa04972	Pancreatic secretion
hsa00590	Arachidonic acid metabolism
hsa00565	Ether lipid metabolism
hsa04975	Fat digestion and absorption
hsa00591	Linoleic acid metabolism
hsa00592	alpha-Linolenic acid metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray