• Gene id: 81575

Gene Summary

• Gene Symbol: APOLD1   Gene   UCSC   Ensembl
• Aliases: VERGE
• Gene name: apolipoprotein L domain containing 1
• Alternate names: apolipoprotein L domain-containing protein 1, vascular early response gene protein,
• Gene location: 12p13.1 (12725916: 12791465)     Exons: 3     NC_000012.12
• Gene summary(Entrez): APOLD1 is an endothelial cell early response protein that may play a role in regulation of endothelial cell signaling and vascular function (Regard et al., 2004 [PubMed 15102925]).[supplied by OMIM, Dec 2008]
• OMIM: 612456

Protein Summary

• Protein general information: Q96LR9  
  • Name: Apolipoprotein L domain containing protein 1 (Vascular early response gene protein)
  • Length: 279  
  • Mass: 30546
  • Tissue specificity: Expressed in neonatal dermal microvascular endothelial cells. {ECO
• Sequence:

  MFRAPCHRLRARGTRKARAGAWRGCTFPCLGKGMERPAAREPHGPDALRRFQGLLLDRRGRLHGQVLRLREVARR
  LERLRRRSLVANVAGSSLSATGALAAIVGLSLSPVTLGTSLLVSAVGLGVATAGGAVTITSDLSLIFCNSRELRR
  VQEIAATCQDQMREILSCLEFFCRWQGCGDRQLLQCGRNASIALYNSVYFIVFFGSRGFLIPRRAEGDTKVSQAV
  LKAKIQKLAESLESCTGALDELSEQLESRVQLCTKSSRGHDLKISADQRAGLFF

• Structural information:
  • Interpro: IPR008405  
  • STRING: ENSP00000324277
• Other Databases: GeneCards:  APOLD1  Malacards:  APOLD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045601	regulation of endothelial cell differentiation	IBA	biological process
GO:0008289	lipid binding	IBA	molecular function
GO:0001525	angiogenesis	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0042157	lipoprotein metabolic process	IEA	biological process
GO:0006869	lipid transport	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0001525	angiogenesis	IEA	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:0045601	regulation of endothelial cell differentiation	IEA	biological process
GO:0042118	endothelial cell activation	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray