• Gene id: 81573

Gene Summary

• Gene Symbol: ANKRD13C   Gene   UCSC   Ensembl
• Aliases: dJ677H15.3
• Gene name: ankyrin repeat domain 13C
• Alternate names: ankyrin repeat domain-containing protein 13C,
• Gene location: 1p31.1 (70354976: 70258998)     Exons: 3     NC_000001.11
• OMIM: 615125

Protein Summary

• Protein general information: Q8N6S4  
  • Name: Ankyrin repeat domain containing protein 13C
  • Length: 541  
  • Mass: 60818
• Sequence:

  MTGEKIRSLRRDHKPSKEEGDLLEPGDEEAAAALGGTFTRSRIGKGGKACHKIFSNHHHRLQLKAAPASSNPPGA
  PALPLHNSSVTANSQSPALLAGTNPVAVVADGGSCPAHYPVHECVFKGDVRRLSSLIRTHNIGQKDNHGNTPLHL
  AVMLGNKECAHLLLAHNAPVKVKNAQGWSPLAEAISYGDRQMITALLRKLKQQSRESVEEKRPRLLKALKELGDF
  YLELHWDFQSWVPLLSRILPSDACKIYKQGINIRLDTTLIDFTDMKCQRGDLSFIFNGDAAPSESFVVLDNEQKV
  YQRIHHEESEMETEEEVDILMSSDIYSATLSTKSISFTRAQTGWLFREDKTERVGNFLADFYLVNGLVLESRKRR
  EHLSEEDILRNKAIMESLSKGGNIMEQNFEPIRRQSLTPPPQNTITWEEYISAENGKAPHLGRELVCKESKKTFK
  ATIAMSQEFPLGIELLLNVLEVVAPFKHFNKLREFVQMKLPPGFPVKLDIPVFPTITATVTFQEFRYDEFDGSIF
  TIPDDYKEDPSRFPDL

• Structural information:
  • Interpro: IPR021832  IPR002110  IPR020683  IPR036770  
  • Prosite: PS50297 PS50088
  • STRING: ENSP00000359982
• Other Databases: GeneCards:  ANKRD13C  Malacards:  ANKRD13C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0006621	protein retention in ER lumen	IBA	biological process
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0010869	regulation of receptor biosynthetic process	IBA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IDA	colocalizes with
GO:0010869	regulation of receptor biosynthetic process	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:2000209	regulation of anoikis	IDA	biological process
GO:0006621	protein retention in ER lumen	IMP	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq