• Gene id: 81569

Gene Summary

• Gene Symbol: ACTL8   Gene   UCSC   Ensembl
• Aliases: CT57
• Gene name: actin like 8
• Alternate names: actin-like protein 8, actin like protein, cancer/testis antigen 57,
• Gene location: 1p36.13 (17755332: 17827062)     Exons: 4     NC_000001.11

Protein Summary

• Protein general information: Q9H568  
  • Name: Actin like protein 8 (Cancer/testis antigen 57) (CT57)
  • Length: 366  
  • Mass: 41360
  • Tissue specificity: Strongly expressed in testis and pancreas. Weak expression in placenta. {ECO
• Sequence:

  MAARTVIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLGIDICHPDTFSYPIERGRILNW
  EGVQYLWSFVLENHRREQEVPPVIITETPLREPADRKKMLEILFELLHVPSVLLADQLQMSLYASGLLTGVVVDS
  GYGLTRVQPFHQGRPLPASGKTLEFAGQDLSAYLLKSLFKEDCDRRCLFQLETVAVTQMNKCYVPQNLGEALDFR
  ERQQSALDESNTYQLPDGSRVELTPMQRVAPEMFFSPQVFEQPGPSIPRAIVESVESCEISLRPLLVSHVMACGG
  NTLYPGFTKRLFRELMGDHVSSTKATVWEGSNRNFSVWLGASVVAHLSTYQSEWMSREEYGEHMRM

• Structural information:
  • Interpro: IPR004000  
  • STRING: ENSP00000364555
• Other Databases: GeneCards:  ACTL8  Malacards:  ACTL8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005884	actin filament	IBA	cellular component
GO:0098973	structural constituent of postsynaptic actin cytoskeleton	IBA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0098974	postsynaptic actin cytoskeleton organization	IEA	biological process
GO:0030855	epithelial cell differentiation	IEP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq