• Gene id: 81567

Gene Summary

• Gene Symbol: TXNDC5   Gene   UCSC   Ensembl
• Aliases: ENDOPDI, ERP46, HCC-2, HCC2, PDIA15, STRF8, UNQ364
• Gene name: thioredoxin domain containing 5
• Alternate names: thioredoxin domain-containing protein 5, ER protein 46, endoplasmic reticulum protein ERp46, endoplasmic reticulum resident protein 46, endothelial protein disulphide isomerase, epididymis secretory sperm binding protein, protein disulfide isomerase family A, m,
• Gene location: 6p24.3 (7910787: 7881513)     Exons: 11     NC_000006.12
• Gene summary(Entrez): This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal endoplasmic reticulum (ER)-signal sequ
• OMIM: 605200

Protein Summary

• Protein general information: Q8NBS9  
  • Name: Thioredoxin domain containing protein 5 (Endoplasmic reticulum resident protein 46) (ER protein 46) (ERp46) (Thioredoxin like protein p46)
  • Length: 432  
  • Mass: 47629
• Sequence:

  MPARPGRLLPLLARPAALTALLLLLLGHGGGGRWGARAQEAAAAAADGPPAADGEDGQDPHSKHLYTADMFTHGI
  QSAAHFVMFFAPWCGHCQRLQPTWNDLGDKYNSMEDAKVYVAKVDCTAHSDVCSAQGVRGYPTLKLFKPGQEAVK
  YQGPRDFQTLENWMLQTLNEEPVTPEPEVEPPSAPELKQGLYELSASNFELHVAQGDHFIKFFAPWCGHCKALAP
  TWEQLALGLEHSETVKIGKVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTETG
  ATETVTPSEAPVLAAEPEADKGTVLALTENNFDDTIAEGITFIKFYAPWCGHCKTLAPTWEELSKKEFPGLAGVK
  IAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSLHRFVLSQAKDEL

• Structural information:
  • Protein Domains: (36..16-)
    (/note="Thioredoxin-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00691-)
    (170..29-)
    (/note="Thioredoxin-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00691-)
    (304..42-)
    (/note="Thioredoxin-3)
    (/evidence="ECO:0000255|PROSITE-)
  • Interpro: IPR005788  IPR036249  IPR017937  IPR013766  
  • Prosite: PS00014 PS00194 PS51352
  • PDB: 2DIZ 3UJ1 3UVT 3WGD 3WGE 3WGX
  • PDBsum: 2DIZ 3UJ1 3UVT 3WGD 3WGE 3WGX
  • DIP: 53700
  • STRING: ENSP00000369081
• Other Databases: GeneCards:  TXNDC5  Malacards:  TXNDC5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043277	apoptotic cell clearance	IBA	biological process
GO:0003756	protein disulfide isomerase activity	IEA	molecular function
GO:0045454	cell redox homeostasis	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0035578	azurophil granule lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005788	endoplasmic reticulum lumen	IEA	cellular component
GO:0005788	endoplasmic reticulum lumen	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0005783	endoplasmic reticulum	TAS	cellular component
GO:0043277	apoptotic cell clearance	IBA	biological process
GO:0003756	protein disulfide isomerase activity	IEA	molecular function
GO:0045454	cell redox homeostasis	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0035578	azurophil granule lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005788	endoplasmic reticulum lumen	IEA	cellular component
GO:0005788	endoplasmic reticulum lumen	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0005783	endoplasmic reticulum	TAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04141	Protein processing in endoplasmic reticulum

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881